Comparing HSERO_RS05560 FitnessBrowser__HerbieS:HSERO_RS05560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
55% identity, 88% coverage: 41:347/348 of query aligns to 5:311/312 of 4oanA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
33% identity, 80% coverage: 40:319/348 of query aligns to 23:302/329 of P44542
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
32% identity, 80% coverage: 41:319/348 of query aligns to 1:279/308 of 2wx9A
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
32% identity, 80% coverage: 41:319/348 of query aligns to 1:279/309 of 2v4cA
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
32% identity, 80% coverage: 41:319/348 of query aligns to 1:279/310 of 3b50A
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
32% identity, 80% coverage: 42:319/348 of query aligns to 1:278/304 of 2cexA
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
32% identity, 80% coverage: 42:319/348 of query aligns to 1:278/305 of 2cexB
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
32% identity, 80% coverage: 41:319/348 of query aligns to 1:279/308 of 2xwoA
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
31% identity, 86% coverage: 42:341/348 of query aligns to 1:301/305 of 4mnpA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 70% coverage: 46:287/348 of query aligns to 9:245/310 of 7bbrA
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 70% coverage: 46:287/348 of query aligns to 8:244/310 of 7bcrA
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 70% coverage: 46:287/348 of query aligns to 8:244/310 of 7bcpA
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 70% coverage: 46:287/348 of query aligns to 8:244/310 of 7bcoA
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 70% coverage: 46:287/348 of query aligns to 8:244/310 of 7bcnA
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
30% identity, 81% coverage: 55:335/348 of query aligns to 9:287/300 of 4n8yA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
30% identity, 84% coverage: 44:335/348 of query aligns to 4:302/314 of 4p8bA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
28% identity, 80% coverage: 65:341/348 of query aligns to 24:298/303 of 4pddA
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
31% identity, 73% coverage: 68:320/348 of query aligns to 30:282/304 of 4pakA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
31% identity, 73% coverage: 68:320/348 of query aligns to 29:281/303 of 4p9kA
Sites not aligning to the query:
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
33% identity, 66% coverage: 41:271/348 of query aligns to 2:232/308 of 4mmpA
>HSERO_RS05560 FitnessBrowser__HerbieS:HSERO_RS05560
MNQDNSKPGKTSVSRRQLLKAGAVGAALPLFSIMSRPANAAEFNYKFATGQDPSHPVNKR
AQQAIDRIREATGGRLDIKLFPANQLGSDTDLMSQIRNGGVEFFNQASVVLSTLVPAAGI
VNTGFAFHDYKEVWQAMDGPLGAYVRAQIEKVGLLTMSKPWDNGFRQITTSTKPIKTAAD
LKGLKLRVPAAPMLTSLFSALGASPTPINFNEVYSSLQTKLVEGQENPLAIISTARLYEV
QKFCTISNHVWDAYWILGNRRAFEKLPKDIQEIVRRELDKAATDERADIASLSGFARNDL
QGKGVQIIEADKNSFKEALARGSFYKDLRAKFGDDAWKLLQNSVGSLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory