Comparing HSERO_RS05590 FitnessBrowser__HerbieS:HSERO_RS05590 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q8K4H1 Kynurenine formamidase; KFA; KFase; Arylformamidase; N-formylkynurenine formamidase; FKF; EC 3.5.1.9 from Mus musculus (Mouse) (see paper)
27% identity, 98% coverage: 4:275/277 of query aligns to 13:301/305 of Q8K4H1
6ieyA Crystal structure of chloramphenicol-metabolizaing enzyme estdl136- chloramphenicol complex (see paper)
36% identity, 36% coverage: 61:161/277 of query aligns to 56:158/307 of 6ieyA
Sites not aligning to the query:
4po3X Crystal structure of a c4-c4 sn3 tributyrin phosphonate inhibited by esterase b from lactobacillus rhamnosis
31% identity, 38% coverage: 61:164/277 of query aligns to 55:160/309 of 4po3X
Sites not aligning to the query:
4n5iX Crystal structure of a c8-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
31% identity, 38% coverage: 61:164/277 of query aligns to 52:157/311 of 4n5iX
Sites not aligning to the query:
4oukX Crystal structure of a c6-c4 sn3 inhibited esterase b from lactobacillus rhamnosis
31% identity, 38% coverage: 61:164/277 of query aligns to 52:157/309 of 4oukX
Sites not aligning to the query:
Q5ATJ7 Non-reducing polyketide synthase ausA; Austinoid biosynthesis clusters protein A; Methylorcinaldehyde synthase ausA; EC 2.3.1.- from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
32% identity, 45% coverage: 46:171/277 of query aligns to 2146:2271/2476 of Q5ATJ7
Sites not aligning to the query:
5aocA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-valerate bound (see paper)
32% identity, 36% coverage: 60:158/277 of query aligns to 37:136/277 of 5aocA
Sites not aligning to the query:
5aobA The structure of a novel thermophilic esterase from the planctomycetes species, thermogutta terrifontis, est2-butyrate bound (see paper)
32% identity, 36% coverage: 60:158/277 of query aligns to 33:132/278 of 5aobA
7bfrA Thermogutta terrifontis esterase 2 phosphorylated by paraoxon (see paper)
32% identity, 36% coverage: 60:158/277 of query aligns to 33:132/260 of 7bfrA
Sites not aligning to the query:
>HSERO_RS05590 FitnessBrowser__HerbieS:HSERO_RS05590
MKIYRDYTSEELDAQYNVRARVPDFQDYFDRFARQGEAARQAHPHLADLPYGEETLQSID
FFPAHSNGRPLLVFIHGGYWRSLDKHQFSHLALPYLEQDINVALINYRLAPQVRMGDIAA
DCGRALRLLHAKAPALRVDANAIWLMGHSAGAHLACVIAALRAAPVRGVCALSGLYDLEP
IRLSYLNEALHLSPADVQQASPLLLAMPDGVRAVLCAGGQESEEFLRQRDVYAANLRQSG
HQVEVVEAAQAHHLSIIDVAADGQSAFTRTVLRMMQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory