SitesBLAST
Comparing HSERO_RS05610 FitnessBrowser__HerbieS:HSERO_RS05610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5ti1H Crystal structure of fumarylacetoacetate hydrolase from burkholderia xenovorans lb400
48% identity, 98% coverage: 4:444/448 of query aligns to 1:428/430 of 5ti1H
- active site: D139 (= D146), H146 (= H153), E212 (= E218), E214 (= E220), D246 (= D252), R250 (= R256), Q253 (= Q259), K266 (= K272), T270 (≠ S276), E377 (= E392)
- binding magnesium ion: D139 (= D146), E212 (= E218), E214 (= E220), D246 (= D252)
P16930 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Homo sapiens (Human) (see 14 papers)
48% identity, 95% coverage: 18:444/448 of query aligns to 2:415/419 of P16930
- S2 (= S18) modified: N-acetylserine
- N16 (= N34) to I: in TYRSN1; loss of activity; dbSNP:rs121965073
- A35 (= A54) to T: in TYRSN1; atypical mild phenotype
- F62 (≠ H83) to C: in TYRSN1; loss of activity
- A134 (= A154) to D: in TYRSN1; loss of activity; dbSNP:rs121965074
- C193 (= C212) to R: in TYRSN1; loss of activity
- D233 (= D252) to V: in TYRSN1; loss of activity; dbSNP:rs80338897
- W234 (= W253) to G: in TYRSN1; loss of activity; dbSNP:rs1555441595
- Q279 (≠ G300) to R: in TYRSN1; may affect splicing resulting in skipping of exon 8 alone or together with exon 9; lower activity as compared to wild type; dbSNP:rs121965078
- R341 (= R369) to W: does not cause a clinically relevant phenotype; results in lower enzyme activity; dbSNP:rs11555096
- P342 (= P370) to L: in TYRSN1; loss of activity; dbSNP:rs779040832
- R381 (= R409) to G: in TYRSN1; loss of activity; dbSNP:rs121965077
- F405 (= F434) to H: in TYRSN1; requires 2 nucleotide substitutions
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
46% identity, 96% coverage: 18:446/448 of query aligns to 4:419/419 of 1hyoB
- active site: D128 (= D146), H135 (= H153), E201 (= E218), E203 (= E220), D235 (= D252), R239 (= R256), Q242 (= Q259), K255 (= K272), T259 (≠ S276), E366 (= E392)
- binding acetate ion: Y130 (= Y148), V139 (= V157), R144 (= R162)
- binding calcium ion: D128 (= D146), E201 (= E218), E203 (= E220), D235 (= D252)
- binding 4-[hydroxy-[methyl-phosphinoyl]]-3-oxo-butanoic acid: D128 (= D146), F129 (= F147), Y130 (= Y148), H135 (= H153), Y161 (= Y178), K255 (= K272), G351 (= G377), T352 (= T378)
- binding magnesium ion: D235 (= D252), W236 (= W253), K255 (= K272), G258 (≠ A275), T259 (≠ S276)
P35505 Fumarylacetoacetase; FAA; Beta-diketonase; Fumarylacetoacetate hydrolase; EC 3.7.1.2 from Mus musculus (Mouse) (see 3 papers)
46% identity, 96% coverage: 18:446/448 of query aligns to 2:417/419 of P35505
- D126 (= D146) binding
- E199 (= E218) binding
- E201 (= E220) binding ; mutation to G: Decrease in activity.
- D233 (= D252) binding ; binding
- K253 (= K272) binding
- T257 (≠ S276) binding
2hzyA Mouse fumarylacetoacetate hydrolase complexes with a transition-state mimic of the complete substrate (see paper)
46% identity, 95% coverage: 18:444/448 of query aligns to 2:415/416 of 2hzyA
- active site: D126 (= D146), H133 (= H153), E199 (= E218), E201 (= E220), D233 (= D252), R237 (= R256), Q240 (= Q259), K253 (= K272), T257 (≠ S276), E364 (= E392)
- binding calcium ion: G122 (= G142), D123 (= D143)
- binding manganese (ii) ion: D126 (= D146), E199 (= E218), E201 (= E220), D233 (= D252)
1qcoA Crystal structure of fumarylacetoacetate hydrolase complexed with fumarate and acetoacetate (see paper)
46% identity, 95% coverage: 18:444/448 of query aligns to 2:415/416 of 1qcoA
- active site: K253 (= K272)
- binding acetoacetic acid: D126 (= D146), F127 (= F147), Y128 (= Y148), H133 (= H153), Y159 (= Y178), E199 (= E218), K253 (= K272), G349 (= G377), T350 (= T378)
- binding calcium ion: D126 (= D146), E199 (= E218), E201 (= E220), D233 (= D252)
- binding fumaric acid: Y128 (= Y148), V137 (= V157), R142 (= R162), Q240 (= Q259), Y244 (= Y263)
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
27% identity, 49% coverage: 199:418/448 of query aligns to 97:260/277 of 6iymA
Query Sequence
>HSERO_RS05610 FitnessBrowser__HerbieS:HSERO_RS05610
MSLSSLTLNETHDTELRSWVPSANADGCPFPIQNLPYGVFRRAGSEEDFRVGVAIGDQIL
DLPAAQSAGAFSGFDEATRQAAHAACSGSRLNALMALTPASWSALRLALSHLLRTASPHQ
TELAACLVPQAQAEYDVPAAIGDYTDFYTSIHHATTVGKLFRPDNPLLPNYKWVPIGYHG
RVSSIAVSGQQFRRPLGQTKAPDADAPTFGPCKRLDYELEIGIFIGGGNAMGEPVPMEEA
EDKVFGLCLLNDWSARDVQAWEYQPLGPFLSKSFASTISPWIVTLEALAPYRCSWSRPDG
DPQPLPYLDAPTLRTQGAFDVQLEVLIQTAAMRQAGQPPQRLSLSNYRDAYWTVAQLVTH
HTVNGCNLRPGDFLGSGTLSGPAPDEAGSLLELTTGGKSPLTLASGEKRVFLEDGDTIIL
RAVARRDGLPLIGFGESAGTVLPARSQG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory