Comparing HSERO_RS05615 FitnessBrowser__HerbieS:HSERO_RS05615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
50% identity, 99% coverage: 4:215/215 of query aligns to 5:214/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
50% identity, 99% coverage: 4:215/215 of query aligns to 3:212/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
50% identity, 99% coverage: 4:215/215 of query aligns to 3:212/212 of O86043
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
50% identity, 98% coverage: 4:214/215 of query aligns to 4:206/208 of 1fw1A
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
49% identity, 98% coverage: 4:214/215 of query aligns to 8:210/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
49% identity, 98% coverage: 4:214/215 of query aligns to 5:207/212 of 2cz2A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
49% identity, 98% coverage: 4:214/215 of query aligns to 8:210/216 of O43708
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
48% identity, 98% coverage: 4:214/215 of query aligns to 12:214/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
48% identity, 98% coverage: 4:214/215 of query aligns to 10:212/220 of 4kaeA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
40% identity, 100% coverage: 1:214/215 of query aligns to 2:214/216 of 4pxoA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
39% identity, 99% coverage: 1:213/215 of query aligns to 1:224/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
38% identity, 98% coverage: 4:214/215 of query aligns to 6:223/228 of 3n5oA
4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
27% identity, 89% coverage: 16:207/215 of query aligns to 18:202/223 of 4pngB
Sites not aligning to the query:
4nhwD Crystal structure of glutathione transferase smc00097 from sinorhizobium meliloti, target efi-507275, with one glutathione bound per one protein subunit
29% identity, 95% coverage: 1:204/215 of query aligns to 9:206/217 of 4nhwD
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
32% identity, 80% coverage: 2:172/215 of query aligns to 4:158/215 of 4chsA
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
27% identity, 99% coverage: 1:212/215 of query aligns to 2:198/201 of 3m3mA
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
25% identity, 86% coverage: 1:185/215 of query aligns to 2:172/204 of 4qq7A
6wegD Structure of ft (mgla-sspa)-ppgpp-pigr peptide complex (see paper)
27% identity, 85% coverage: 1:183/215 of query aligns to 3:170/194 of 6wegD
6srbB Crystal structure of glutathione transferase omega 3c from trametes versicolor (see paper)
27% identity, 75% coverage: 15:176/215 of query aligns to 32:177/233 of 6srbB
Sites not aligning to the query:
4topA Glycine max glutathione transferase
27% identity, 98% coverage: 2:211/215 of query aligns to 4:202/218 of 4topA
>HSERO_RS05615 FitnessBrowser__HerbieS:HSERO_RS05615
MTTLYSYFRSSASYRVRIALHLKDLPYETVPVHLLNQGGEQLLPAFTEINPHALVPVLAE
EGHYVSQSLAMLELLEERHPTPSLLPGDAFQRAHIRALSLAIACDIHPLNNLRVLKYLKR
ELGMDDERKNAWIAHWINLGFTALERQLAADTTRGHFCVGDAPTMADCCLVPQIFNARRF
EVDMAPYPTLCAIEQACHALPAFQQAHPAQQPDAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory