SitesBLAST
Comparing HSERO_RS05655 FitnessBrowser__HerbieS:HSERO_RS05655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
42% identity, 89% coverage: 34:308/308 of query aligns to 41:315/315 of 5vg6B
- active site: M98 (≠ I91), R230 (= R223), D254 (= D247), E259 (= E252), H278 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A67), R92 (= R85), M102 (= M95), L147 (= L140), G148 (= G141), D149 (≠ M142), L150 (= L143), W168 (= W161), S169 (= S162), R170 (= R163), T171 (≠ S164), K173 (≠ H166), L201 (≠ V194), P202 (= P195), T207 (= T200), V228 (= V221), R230 (= R223), H278 (= H271), A280 (= A273), S281 (= S274), Y315 (= Y308)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
36% identity, 95% coverage: 15:308/308 of query aligns to 16:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A66 (= A67), R90 (= R85), M100 (= M95), A145 (≠ L140), G146 (= G141), V147 (≠ M142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (≠ H166), L199 (≠ V194), P200 (= P195), L226 (≠ V221), A227 (≠ G222), R228 (= R223), D252 (= D247), H276 (= H271), A279 (≠ S274), Y313 (= Y308)
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
36% identity, 95% coverage: 15:308/308 of query aligns to 15:312/312 of 7jqiA
- binding 2-oxoglutaric acid: G64 (= G66), A65 (= A67), G66 (= G68), R227 (= R223), H275 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L198 (≠ V194), P199 (= P195), L225 (≠ V221), R227 (= R223), H275 (= H271), A278 (≠ S274), Y312 (= Y308)
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
36% identity, 95% coverage: 15:308/308 of query aligns to 15:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A65 (= A67), R89 (= R85), M99 (= M95), A144 (≠ L140), G145 (= G141), V146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L198 (≠ V194), P199 (= P195), L225 (≠ V221), R227 (= R223), H275 (= H271), A277 (= A273), A278 (≠ S274), Y312 (= Y308)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: W15 (= W15), A65 (= A67), R227 (= R223), H275 (= H271), T280 (= T276)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
35% identity, 100% coverage: 1:308/308 of query aligns to 1:312/312 of 3kboA
- active site: M95 (≠ I91), R227 (= R223), E256 (= E252), H275 (= H271)
- binding N-(2-hydroxyethyl)-N,N-dimethyl-3-sulfopropan-1-aminium: N36 (≠ G37), A53 (= A53), R55 (= R55), R56 (≠ K58)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), G143 (= G139), A144 (≠ L140), G145 (= G141), V146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), K170 (≠ H166), L197 (= L193), P199 (= P195), L225 (≠ V221), A226 (≠ G222), R227 (= R223), D251 (= D247), H275 (= H271), A278 (≠ S274), Y312 (= Y308)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
38% identity, 89% coverage: 36:308/308 of query aligns to 40:316/316 of 4z0pA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ S242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ H166), L197 (≠ V194), P198 (= P195), A229 (≠ V221), G230 (= G222), R231 (= R223), H279 (= H271), A281 (= A273), A282 (≠ S274), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), H114 (≠ S110), R115 (= R111), R231 (= R223), H279 (= H271)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
38% identity, 89% coverage: 36:308/308 of query aligns to 40:316/316 of 4weqA
- active site: L95 (≠ I91), R231 (= R223), G250 (≠ S242), D255 (= D247), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (= R85), M99 (= M95), M144 (≠ L140), G145 (= G141), V146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), S168 (= S164), R170 (≠ H166), L197 (≠ V194), P198 (= P195), A229 (≠ V221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), A281 (= A273), Y316 (= Y308)
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
35% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 5bqfA
- active site: E261 (= E252), H280 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ M142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), L198 (≠ V194), P199 (= P195), A230 (≠ V221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (≠ S274), Y317 (= Y308)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
35% identity, 89% coverage: 36:308/308 of query aligns to 41:317/317 of 4xcvA
- active site: E261 (= E252), H280 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A67), R90 (= R85), M100 (= M95), G144 (= G139), L145 (= L140), G146 (= G141), I147 (≠ M142), L148 (= L143), W166 (= W161), S167 (= S162), R168 (= R163), T169 (≠ S164), K171 (≠ H166), L198 (≠ V194), P199 (= P195), A230 (≠ V221), G231 (= G222), R232 (= R223), H280 (= H271), A283 (≠ S274), Y317 (= Y308)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
40% identity, 84% coverage: 49:308/308 of query aligns to 58:316/316 of 4zqbB
- active site: L99 (≠ I91), R231 (= R223), E260 (= E252), H279 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (= R85), M103 (= M95), G147 (= G139), L148 (= L140), G149 (= G141), E150 (≠ M142), L151 (= L143), W169 (= W161), S170 (= S162), R171 (= R163), S172 (= S164), K174 (≠ H166), L202 (≠ V194), P203 (= P195), F229 (≠ V221), R231 (= R223), H279 (= H271), S281 (≠ A273), A282 (≠ S274), Y316 (= Y308)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
35% identity, 89% coverage: 36:308/308 of query aligns to 40:316/316 of 5tsdA
- active site: E260 (= E252), H279 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A67), R89 (= R85), M99 (= M95), G143 (= G139), L144 (= L140), G145 (= G141), I146 (≠ M142), L147 (= L143), W165 (= W161), S166 (= S162), R167 (= R163), T168 (≠ S164), K170 (≠ H166), L197 (≠ V194), P198 (= P195), A229 (≠ V221), G230 (= G222), R231 (= R223), D255 (= D247), H279 (= H271), Y316 (= Y308)
- binding oxalic acid: W50 (= W46), G70 (= G66), A71 (= A67), G72 (= G68), R231 (= R223), H279 (= H271)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
31% identity, 77% coverage: 67:302/308 of query aligns to 65:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: A65 (= A67), G66 (= G68), H89 (≠ A92), R224 (= R223), H272 (= H271), Y280 (vs. gap)
- binding magnesium ion: T130 (vs. gap), A132 (≠ S131), F210 (= F209), E211 (≠ A210), M213 (≠ L212), G225 (= G224), P226 (≠ G225), V228 (≠ L227), E230 (= E229), D241 (≠ Q240), S251 (≠ E250)
- binding nicotinamide-adenine-dinucleotide: A65 (= A67), G66 (= G68), T86 (≠ P89), H89 (≠ A92), G142 (= G141), T143 (≠ M142), L144 (= L143), R164 (= R163), P196 (= P195), T201 (= T200), V222 (= V221), A223 (≠ G222), R224 (= R223), H272 (= H271), S274 (≠ A273)
Sites not aligning to the query:
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 77% coverage: 67:302/308 of query aligns to 67:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding (2R)-2-hydroxyhexanoic acid: A67 (= A67), G68 (= G68), H91 (≠ A92), Y282 (vs. gap)
- binding magnesium ion: F212 (= F209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), L143 (= L140), G144 (= G141), T145 (≠ M142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ S177), T197 (≠ V194), P198 (= P195), T203 (= T200), V224 (= V221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
31% identity, 77% coverage: 67:302/308 of query aligns to 67:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: A67 (= A67), G68 (= G68), H91 (≠ A92), R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (vs. gap), A134 (≠ S131)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), L143 (= L140), G144 (= G141), T145 (≠ M142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), P180 (≠ S177), T197 (≠ V194), P198 (= P195), T203 (= T200), V224 (= V221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
31% identity, 77% coverage: 67:302/308 of query aligns to 67:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: A67 (= A67), G68 (= G68), H91 (≠ A92), R226 (= R223), H274 (= H271), Y282 (vs. gap)
- binding magnesium ion: T132 (vs. gap), A134 (≠ S131), F212 (= F209), E213 (≠ A210), M215 (≠ L212), D243 (≠ Q240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A67), G68 (= G68), T88 (≠ P89), G142 (= G139), L143 (= L140), G144 (= G141), T145 (≠ M142), L146 (= L143), R165 (≠ S162), R166 (= R163), S167 (= S164), T197 (≠ V194), P198 (= P195), T203 (= T200), V224 (= V221), A225 (≠ G222), R226 (= R223), H274 (= H271), S276 (≠ A273)
Sites not aligning to the query:
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
31% identity, 81% coverage: 51:299/308 of query aligns to 58:307/311 of 3bazA
- active site: L98 (≠ I91), R230 (= R223), A251 (= A244), D254 (= D247), E259 (= E252), H277 (= H271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A67), G149 (= G139), L150 (= L140), G151 (= G141), R152 (≠ M142), I153 (≠ L143), S172 (= S162), R173 (= R163), S174 (= S164), C201 (≠ V194), P202 (= P195), T207 (= T200), I228 (≠ V221), G229 (= G222), R230 (= R223), D254 (= D247), H277 (= H271), G279 (≠ A273)
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
31% identity, 81% coverage: 51:299/308 of query aligns to 60:309/313 of Q65CJ7
Q9UBQ7 Glyoxylate reductase/hydroxypyruvate reductase; EC 1.1.1.79; EC 1.1.1.81 from Homo sapiens (Human) (see paper)
34% identity, 46% coverage: 135:277/308 of query aligns to 156:299/328 of Q9UBQ7
Sites not aligning to the query:
2gcgA Ternary crystal structure of human glyoxylate reductase/hydroxypyruvate reductase (see paper)
34% identity, 46% coverage: 135:277/308 of query aligns to 152:295/324 of 2gcgA
- active site: R241 (= R223), D265 (= D247), E270 (= E252), H289 (= H271)
- binding (2r)-2,3-dihydroxypropanoic acid: R241 (= R223), H289 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G156 (= G139), G158 (= G141), I160 (≠ L143), G180 (vs. gap), R181 (= R163), R184 (≠ H166), C212 (≠ V194), S213 (≠ P195), T218 (= T200), I239 (≠ V221), R241 (= R223), D265 (= D247), H289 (= H271), G291 (≠ A273)
Sites not aligning to the query:
5v7gA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc04462 (smghrb) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
29% identity, 79% coverage: 49:292/308 of query aligns to 52:298/317 of 5v7gA
- active site: L94 (≠ M95), R228 (= R223), D252 (= D247), E257 (= E252), H275 (= H271)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V70 (≠ A67), V98 (= V99), F146 (≠ L138), L148 (= L140), G149 (= G141), R150 (≠ M142), I151 (≠ L143), T170 (≠ S162), R171 (= R163), V199 (= V194), P200 (= P195), S204 (≠ E199), T205 (= T200), V226 (= V221), G227 (= G222), R228 (= R223), H275 (= H271), A277 (vs. gap)
- binding oxalate ion: G69 (= G66), V70 (≠ A67), G71 (= G68), R228 (= R223), H275 (= H271)
Query Sequence
>HSERO_RS05655 FitnessBrowser__HerbieS:HSERO_RS05655
MTFLYKADPVRGAEWAQLFAQKAPELPFQIWPHDGDGASVRYLAAWTPPDDIAERFPKLE
ILFSVGAGIDQFDMSTLPPALPVVRMTEPGIAAGMVQYVTHAVLGLHRDSRVYARQQRDQ
VWRAHRVRPASACRVGVLGLGMLGRAVLQQLHGLGFPCAGWSRSAHQMDGIDCYSGSAGL
RAFLARTDVLVCLVPLTEETRGLLCRDLFAQLPRGAALINVGRGGHLVEDDLLAALNDGQ
LSAAVLDVCEVEPLPPGHPFWTHPDIVLTPHIASMTQPDGAVDAVLENLRRYREGLPLLG
LIDRQRGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory