SitesBLAST
Comparing HSERO_RS05710 FitnessBrowser__HerbieS:HSERO_RS05710 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6x9lA Crystal structure of aldehyde dehydrogenasE C (aldc) mutant (c291a) from pseudomonas syringae in complexed with NAD+ and octanal (see paper)
68% identity, 96% coverage: 18:484/486 of query aligns to 14:480/485 of 6x9lA
- active site: N154 (= N158), E252 (= E256), A286 (≠ C290), E462 (= E466)
- binding nicotinamide-adenine-dinucleotide: I150 (= I154), T151 (= T155), W153 (= W157), N154 (= N158), Q159 (= Q163), K177 (= K181), E180 (= E184), G210 (= G214), P211 (≠ A215), G214 (= G218), T229 (= T233), G230 (= G234), S231 (= S235), E252 (= E256), L253 (= L257), A286 (≠ C290), E386 (= E390), F388 (= F392), F451 (= F455)
- binding octanal: W155 (= W159), S285 (= S289)
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
44% identity, 96% coverage: 19:485/486 of query aligns to 9:453/454 of 3ty7B
3b4wA Crystal structure of mycobacterium tuberculosis aldehyde dehydrogenase complexed with NAD+
42% identity, 96% coverage: 16:482/486 of query aligns to 6:476/483 of 3b4wA
- active site: N154 (= N158), K177 (= K181), E251 (= E256), C285 (= C290), E384 (= E390), E460 (= E466)
- binding nicotinamide-adenine-dinucleotide: I150 (= I154), V151 (≠ T155), W153 (= W157), N154 (= N158), K177 (= K181), I210 (≠ A215), G213 (= G218), T228 (= T233), G229 (= G234), S230 (= S235), V233 (≠ A238), E236 (≠ L241), E251 (= E256), L252 (= L257), C285 (= C290), E384 (= E390), F386 (= F392)
7qk9A Crystal structure of the aldh1a3-atp complex (see paper)
39% identity, 98% coverage: 5:481/486 of query aligns to 4:484/489 of 7qk9A
- binding adenosine-5'-triphosphate: I158 (= I154), T159 (= T155), P160 (= P156), W161 (= W157), K185 (= K181), E188 (= E184), G218 (= G214), G222 (= G218), F236 (≠ I232), S239 (= S235), V242 (≠ A238)
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
39% identity, 98% coverage: 5:481/486 of query aligns to 5:485/489 of 7a6qB
- active site: N163 (= N158), E262 (= E256), C296 (= C290), E470 (= E466)
- binding nicotinamide-adenine-dinucleotide: I159 (= I154), W162 (= W157), K186 (= K181), E189 (= E184), G219 (= G214), G223 (= G218), S240 (= S235), V243 (≠ A238), K342 (≠ A336)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (= A34), T33 (≠ V35), C34 (≠ V36), P36 (= P38), D103 (≠ E102), E189 (= E184), Q190 (≠ L185), F218 (≠ S213), I339 (≠ A333), D340 (≠ N334)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ L117), D141 (≠ P137), N143 (≠ G139), N451 (≠ P447), L453 (≠ W449), A455 (≠ P451)
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
39% identity, 98% coverage: 5:481/486 of query aligns to 5:485/489 of 7a6qA
- active site: N163 (= N158), E262 (= E256), C296 (= C290), E470 (= E466)
- binding nicotinamide-adenine-dinucleotide: I159 (= I154), T160 (= T155), W162 (= W157), K186 (= K181), A188 (≠ S183), E189 (= E184), G219 (= G214), G223 (= G218), S240 (= S235), V243 (≠ A238), K342 (≠ A336), K346 (≠ R340)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ L117), D141 (≠ P137), N143 (≠ G139), N451 (≠ P447), L453 (≠ W449), Y454 (≠ D450)
5fhzA Human aldehyde dehydrogenase 1a3 complexed with NAD(+) and retinoic acid (see paper)
39% identity, 98% coverage: 5:481/486 of query aligns to 5:485/489 of 5fhzA
- active site: N163 (= N158), K186 (= K181), E262 (= E256), C296 (= C290), E393 (= E390), E470 (= E466)
- binding nicotinamide-adenine-dinucleotide: I159 (= I154), T160 (= T155), W162 (= W157), K186 (= K181), E189 (= E184), G219 (= G214), G223 (= G218), F237 (≠ I232), G239 (= G234), S240 (= S235), T241 (= T236), V243 (≠ A238), G264 (= G258), Q343 (= Q337), E393 (= E390)
- binding retinoic acid: G118 (≠ L117), R121 (≠ E120), F164 (≠ W159), M168 (≠ Q163), W171 (≠ A166), C295 (≠ S289), C296 (= C290), L453 (≠ W449)
P47895 Retinaldehyde dehydrogenase 3; RALDH-3; RalDH3; Aldehyde dehydrogenase 6; Aldehyde dehydrogenase family 1 member A3; ALDH1A3; EC 1.2.1.36 from Homo sapiens (Human) (see 2 papers)
40% identity, 96% coverage: 14:481/486 of query aligns to 30:503/512 of P47895
- R89 (≠ A70) to C: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514652
- K204 (= K181) binding
- E207 (= E184) binding
- GSTEVG 257:262 (≠ GSTRAG 234:239) binding
- Q361 (= Q337) binding
- E411 (= E390) binding
- A493 (≠ G471) to P: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514653
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
4pxlA Structure of zm aldh2-3 (rf2c) in complex with NAD (see paper)
41% identity, 97% coverage: 14:482/486 of query aligns to 4:477/486 of 4pxlA
- active site: N154 (= N158), K177 (= K181), E253 (= E256), C287 (= C290), E384 (= E390), D461 (≠ E466)
- binding nicotinamide-adenine-dinucleotide: I150 (= I154), V151 (≠ T155), P152 (= P156), W153 (= W157), K177 (= K181), E180 (= E184), G210 (= G214), G214 (= G218), A215 (= A219), F228 (≠ I232), G230 (= G234), S231 (= S235), V234 (≠ A238), E253 (= E256), G255 (= G258), C287 (= C290), Q334 (= Q337), K337 (≠ R340), E384 (= E390), F386 (= F392)
6tgwA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with a selective inhibitor (see paper)
40% identity, 96% coverage: 14:481/486 of query aligns to 4:474/478 of 6tgwA
- active site: N155 (= N158), E254 (= E256), C288 (= C290), E459 (= E466)
- binding methyl 5-(1,3-benzodioxol-5-yl)-2-phenyl-pyrazolo[1,5-a]pyrimidine-7-carboxylate: I106 (≠ A113), G110 (≠ L117), F156 (≠ W159), Q278 (≠ A280), F282 (≠ R284), L442 (≠ W449), A444 (≠ P451)
- binding nicotinamide-adenine-dinucleotide: I151 (= I154), T152 (= T155), P153 (= P156), W154 (= W157), K178 (= K181), G211 (= G214), G215 (= G218), F229 (≠ I232), G231 (= G234), S232 (= S235), V235 (≠ A238)
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 97% coverage: 14:482/486 of query aligns to 18:492/501 of Q56YU0
- G152 (vs. gap) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A407) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
6te5B Crystal structure of human aldehyde dehydrogenase 1a3 in complex with lq43 inhibitor compound (see paper)
39% identity, 96% coverage: 14:481/486 of query aligns to 6:474/479 of 6te5B
- active site: N157 (= N158), E256 (= E256), C290 (= C290), E459 (= E466)
- binding 6-(3,5-dimethoxyphenyl)-2-(4-methoxyphenyl)imidazo[1,2-a]pyridine: E111 (≠ P116), G112 (≠ L117), T116 (≠ H121), L442 (≠ W449), A444 (≠ P451)
- binding nicotinamide-adenine-dinucleotide: I153 (= I154), T154 (= T155), W156 (= W157), K180 (= K181), E183 (= E184), G213 (= G214), F231 (≠ I232), S234 (= S235), V237 (≠ A238), Q337 (= Q337), K340 (≠ R340)
6tryA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with mf13 inhibitor compound (see paper)
39% identity, 96% coverage: 14:481/486 of query aligns to 5:473/478 of 6tryA
- active site: N156 (= N158), E255 (= E256), C289 (= C290), E458 (= E466)
- binding nicotinamide-adenine-dinucleotide: I152 (= I154), T153 (= T155), W155 (= W157), K179 (= K181), A181 (≠ S183), E182 (= E184), G212 (= G214), G216 (= G218), A217 (= A219), F230 (≠ I232), G232 (= G234), S233 (= S235), V236 (≠ A238), K335 (≠ A336)
- binding 8-(4-chlorophenyl)-2-phenyl-imidazo[1,2-a]pyridine: I107 (≠ A113), G111 (≠ L117), T115 (≠ H121), L160 (≠ Y162), C288 (≠ S289), L441 (≠ W449), A443 (≠ P451)
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
38% identity, 96% coverage: 17:481/486 of query aligns to 9:482/497 of P17202
- I28 (≠ V36) binding
- D96 (≠ E102) binding
- SPW 156:158 (≠ TPW 155:157) binding
- Y160 (≠ W159) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ A166) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (= KPSE 181:184) binding
- L186 (= L185) binding
- SSAT 236:239 (≠ STRA 235:238) binding
- V251 (= V250) binding in other chain
- L258 (= L257) binding
- W285 (≠ R284) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E390) binding
- A441 (≠ Q441) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- C450 (≠ A448) mutation to S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- W456 (≠ F455) binding ; mutation to A: Decreases binding affinity for betaine aldehyde.
- K460 (= K459) binding
7w5nA The crystal structure of the reduced form of gluconobacter oxydans wsh-004 sndh (see paper)
41% identity, 95% coverage: 18:481/486 of query aligns to 13:480/492 of 7w5nA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: W156 (= W157), K180 (= K181), A182 (≠ S183), T212 (≠ S213), G213 (= G214), G217 (= G218), F231 (≠ I232), G233 (= G234), S234 (= S235), V237 (≠ A238), Q337 (= Q337), E388 (= E390), F390 (= F392)
4fr8A Crystal structure of human aldehyde dehydrogenase-2 in complex with nitroglycerin (see paper)
38% identity, 96% coverage: 16:481/486 of query aligns to 13:484/493 of 4fr8A
- active site: N162 (= N158), K185 (= K181), Q261 (≠ E256), C295 (= C290), E392 (= E390), E469 (= E466)
- binding nicotinamide-adenine-dinucleotide: I158 (= I154), I159 (≠ T155), W161 (= W157), K185 (= K181), G218 (= G214), G222 (= G218), A223 (= A219), F236 (≠ I232), G238 (= G234), S239 (= S235), I242 (≠ A238), Q342 (= Q337), K345 (≠ R340), E392 (= E390), F394 (= F392)
- binding propane-1,2,3-triyl trinitrate: F163 (≠ W159), L166 (≠ Y162), W170 (≠ A166), F289 (≠ R284), S294 (= S289), C295 (= C290), D450 (≠ P447), F452 (≠ W449)
4fr8C Crystal structure of human aldehyde dehydrogenase-2 in complex with nitroglycerin (see paper)
38% identity, 96% coverage: 16:481/486 of query aligns to 16:487/496 of 4fr8C
- active site: N165 (= N158), K188 (= K181), Q264 (≠ E256), C298 (= C290), E395 (= E390), E472 (= E466)
- binding nicotinamide-adenine-dinucleotide: I161 (= I154), I162 (≠ T155), W164 (= W157), K188 (= K181), G221 (= G214), G225 (= G218), A226 (= A219), F239 (≠ I232), G241 (= G234), S242 (= S235), I245 (≠ A238), Q345 (= Q337), E395 (= E390), F397 (= F392)
4v37A Crystal structure of betaine aldehyde dehydrogenase from spinach showing a thiohemiacetal with 3-aminopropionaldehyde
38% identity, 96% coverage: 17:481/486 of query aligns to 7:480/495 of 4v37A
- active site: N157 (= N158), K180 (= K181), E255 (= E256), A289 (≠ C290), E388 (= E390), E465 (= E466)
- binding 3-aminopropan-1-ol: C448 (≠ A448), W454 (≠ F455)
- binding nicotinamide-adenine-dinucleotide: I153 (= I154), S154 (≠ T155), P155 (= P156), W156 (= W157), N157 (= N158), M162 (≠ Q163), K180 (= K181), S182 (= S183), E183 (= E184), G213 (= G214), G217 (= G218), A218 (= A219), T232 (= T233), G233 (= G234), S234 (= S235), T237 (≠ A238), E255 (= E256), L256 (= L257), A289 (≠ C290), E388 (= E390), F390 (= F392)
P20000 Aldehyde dehydrogenase, mitochondrial; ALDH class 2; ALDH-E2; ALDHI; EC 1.2.1.3 from Bos taurus (Bovine) (see 2 papers)
38% identity, 96% coverage: 16:481/486 of query aligns to 40:511/520 of P20000
Sites not aligning to the query:
- 1:21 modified: transit peptide, Mitochondrion
5l13A Structure of aldh2 in complex with 2p3 (see paper)
38% identity, 96% coverage: 16:481/486 of query aligns to 14:485/494 of 5l13A
- active site: N163 (= N158), K186 (= K181), E262 (= E256), C296 (= C290), E393 (= E390), E470 (= E466)
- binding 2,3,5-trimethyl-6-propyl-7H-furo[3,2-g][1]benzopyran-7-one: F164 (≠ W159), M168 (≠ Q163), W171 (≠ A166), F290 (≠ R284), C295 (≠ S289), C296 (= C290), C297 (≠ S291), D451 (≠ P447), F453 (≠ W449)
Query Sequence
>HSERO_RS05710 FitnessBrowser__HerbieS:HSERO_RS05710
MTSSPLTHLTRNARLDHFYIDGKWQPPQGSERAAVVAPATEERVCEIALGNAADVDQAVQ
AARRAIPAWAATSPLERAALLGRVHALLLERSELFAQALTLEMGAPISYARTAHVPLAAE
HLRVARDNLADYPFIRPRGTTAIVREPIGVCALITPWNWPIYQITAKVGPALAAGCTVVL
KPSELSPLSALLFAEIVHEAGVPAGVFNLVNGSGAEVGAALSAHPQVDMISITGSTRAGV
LVAQAAAVTVKRVAQELGGKSPNLVLPDADLERAIPPGVAAALRNMGQSCSAPTRLIVPR
AALARVHELALATLAQMKVGDPNDAATTHGPLANRAQFLRVQQMIEAGLQDGARLLAGGP
GRPDGLAQGYYARPTIFSEVHTDMVIAQEEIFGPVLAILPYDTVEEAIAIANDTVYGLGA
HVQGRDKDQVRAVAARIQSGQVHLNYPAWDPQAPFGGYKQSGNGREYGVEGMEEYMEVKA
ILGYYA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory