Comparing HSERO_RS05715 FitnessBrowser__HerbieS:HSERO_RS05715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
37% identity, 91% coverage: 20:387/403 of query aligns to 12:372/380 of P54955
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 93% coverage: 18:391/403 of query aligns to 47:423/440 of O04373
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 92% coverage: 20:391/403 of query aligns to 54:427/442 of P54968
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
31% identity, 91% coverage: 9:373/403 of query aligns to 7:370/389 of 4ewtA
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
37% identity, 83% coverage: 9:341/403 of query aligns to 10:344/398 of 6slfA
Sites not aligning to the query:
3rzaA Crystal structure of a tripeptidase (sav1512) from staphylococcus aureus subsp. Aureus mu50 at 2.10 a resolution
23% identity, 55% coverage: 81:300/403 of query aligns to 85:288/373 of 3rzaA
Sites not aligning to the query:
>HSERO_RS05715 FitnessBrowser__HerbieS:HSERO_RS05715
MEHTGHQHDTLHQHRAHWAGLRRDLHAHPELRFEEHRTADVVVRELQSLGYTVTRGLGGT
GVVASLAGADPQRGIVLRADLDALPIVEANDFAHASCTHGVMHACGHDGHTVMLLGAARL
LKQGPMLPGSVHFVFQPGEEGGAGARKMIDDGLFEQFPTEAVFGMHNWPGLPAGQFGLRP
GPIMAAGSRLKITITGKGAHAAQPHLGLDPIPLACSMVLQCQTIAARHKDPVDPAVISVC
MFHAGDTDNVIPDRAELRGTIRTLSSTLQQKLQEDIRRMCHALAEAYGAKVEVEFFQYYP
ATINTPAETDFCERVIRQTFGDDRIRTGIPANMTSEDFGFMLEERPGAYVLIGNAPQDRA
SHSLHHPHYDFNDDIIEAGVRYWVALAQGYFGSGLKGEAVTSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory