Comparing HSERO_RS05835 FitnessBrowser__HerbieS:HSERO_RS05835 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3c4jA Abc protein artp in complex with atp-gamma-s
58% identity, 99% coverage: 1:240/242 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
58% identity, 99% coverage: 1:240/242 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
58% identity, 99% coverage: 1:240/242 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
58% identity, 99% coverage: 1:240/242 of query aligns to 3:242/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
56% identity, 99% coverage: 1:240/242 of query aligns to 1:240/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
57% identity, 99% coverage: 1:240/242 of query aligns to 2:240/241 of 4u00A
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
55% identity, 100% coverage: 2:242/242 of query aligns to 3:255/258 of 1b0uA
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
55% identity, 98% coverage: 2:237/242 of query aligns to 7:254/258 of P02915
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
37% identity, 99% coverage: 1:240/242 of query aligns to 1:245/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
36% identity, 99% coverage: 1:240/242 of query aligns to 2:246/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
36% identity, 99% coverage: 1:240/242 of query aligns to 2:246/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
36% identity, 99% coverage: 1:240/242 of query aligns to 2:246/344 of 6cvlD
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
35% identity, 97% coverage: 2:236/242 of query aligns to 3:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
35% identity, 97% coverage: 2:236/242 of query aligns to 3:263/382 of 7aheC
Sites not aligning to the query:
P0AAH0 Phosphate import ATP-binding protein PstB; ABC phosphate transporter; Phosphate-transporting ATPase; EC 7.3.2.1 from Escherichia coli (strain K12) (see paper)
35% identity, 97% coverage: 2:236/242 of query aligns to 11:252/257 of P0AAH0
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
36% identity, 93% coverage: 2:227/242 of query aligns to 3:254/260 of 7ahdC
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
40% identity, 88% coverage: 1:214/242 of query aligns to 1:223/232 of 1f3oA
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
40% identity, 92% coverage: 1:223/242 of query aligns to 3:229/615 of 5lilA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
40% identity, 92% coverage: 1:223/242 of query aligns to 3:229/592 of 5lj7A
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
40% identity, 88% coverage: 1:214/242 of query aligns to 1:223/230 of 1l2tA
>HSERO_RS05835 FitnessBrowser__HerbieS:HSERO_RS05835
MIEVKRISKCFGRHEVLKDVSLSVAQGEVVCLIGPSGSGKSTVLRCINGLESYERGDILI
DGQRVDRDGPDIHRLRTRVGMVFQRFNLFPHRTVLENVTEGPIYVNGLARAQARSEAMSL
LDKVGLAARCDAYPAQLSGGQQQRVAIARSLAMQPEAILFDEPTSALDPELVGEVLAVMR
TLAADGMTMIVVTHEMGFAREVADRVCFLHSGSIVESGAAAQVLAEPQHARTQDFLRRVI
GK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory