SitesBLAST
Comparing HSERO_RS06350 FitnessBrowser__HerbieS:HSERO_RS06350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6d9yB Crystal structure of a short chain dehydrogenase/reductase sdr from burkholderia phymatum with partially occupied NAD
56% identity, 100% coverage: 1:250/250 of query aligns to 2:251/251 of 6d9yB
- active site: G20 (= G19), S145 (= S144), Y158 (= Y157)
- binding nicotinamide-adenine-dinucleotide: G16 (= G15), R19 (≠ Q18), G20 (= G19), D40 (= D39), L41 (≠ M40), V64 (= V63), D65 (= D64), Q66 (≠ I65), A93 (= A92), S145 (= S144), Y158 (= Y157), K162 (= K161), P188 (= P187), A189 (= A188), A190 (= A189), A191 (= A190), T193 (= T192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
36% identity, 95% coverage: 9:246/250 of query aligns to 6:244/248 of 6ixmC
- active site: G16 (= G19), S142 (= S144), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), S15 (≠ Q18), G16 (= G19), I17 (≠ F20), D36 (= D39), I37 (≠ M40), A61 (≠ V63), D62 (= D64), T63 (≠ I65), N89 (≠ S91), A90 (= A92), M140 (≠ I142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (= A188), Y187 (≠ A189), I188 (≠ A190), L192 (≠ I194)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
34% identity, 96% coverage: 6:246/250 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G19), N111 (≠ D116), S139 (= S144), Q149 (≠ A154), Y152 (= Y157), K156 (= K161)
- binding acetoacetyl-coenzyme a: D93 (≠ N98), K98 (≠ E103), S139 (= S144), N146 (= N151), V147 (≠ P152), Q149 (≠ A154), Y152 (= Y157), F184 (≠ A189), M189 (≠ I194), K200 (≠ Y205)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), N17 (≠ Q18), G18 (= G19), I19 (≠ F20), D38 (= D39), F39 (≠ M40), V59 (= V63), D60 (= D64), V61 (≠ I65), N87 (≠ S91), A88 (= A92), G89 (= G93), I90 (= I94), T137 (≠ I142), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), F184 (≠ A189), T185 (≠ A190), T187 (= T192), M189 (≠ I194)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 97% coverage: 4:246/250 of query aligns to 2:248/252 of 1vl8B
- active site: G17 (= G19), S143 (= S144), I154 (≠ A154), Y157 (= Y157), K161 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G15), R16 (≠ Q18), G17 (= G19), L18 (≠ F20), S37 (≠ D39), R38 (≠ M40), C63 (≠ V63), D64 (= D64), V65 (≠ I65), A91 (≠ S91), A92 (= A92), G93 (= G93), I94 (= I94), V114 (≠ I115), I141 (= I142), S143 (= S144), Y157 (= Y157), K161 (= K161), P187 (= P187), G188 (≠ A188), Y190 (≠ A190), T192 (= T192), M194 (≠ I194), T195 (≠ L195)
1zemA Crystal structure of NAD+-bound xylitol dehydrogenase (see paper)
31% identity, 96% coverage: 6:246/250 of query aligns to 3:260/260 of 1zemA
- active site: N16 (≠ G19), S142 (= S144), Y155 (= Y157), K159 (= K161), D212 (≠ C198)
- binding nicotinamide-adenine-dinucleotide: G12 (= G15), G15 (≠ Q18), N16 (≠ G19), I17 (≠ F20), D36 (= D39), M37 (= M40), D62 (= D64), V63 (≠ I65), N89 (≠ S91), A90 (= A92), G91 (= G93), T140 (≠ I142), S142 (= S144), Y155 (= Y157), K159 (= K161), P185 (= P187), M188 (vs. gap)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
31% identity, 100% coverage: 1:250/250 of query aligns to 4:249/254 of 3o03A
- active site: G22 (= G19), S147 (= S144), V157 (≠ A154), Y160 (= Y157), K164 (= K161)
- binding calcium ion: S147 (= S144), M148 (≠ I145), P190 (= P187)
- binding D-gluconic acid: I99 (≠ A95), R101 (≠ N98), S147 (= S144), M149 (≠ A146), R154 (≠ N151), Y160 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G15), Y21 (≠ Q18), G22 (= G19), I23 (≠ F20), D42 (= D39), I43 (≠ M40), L47 (≠ A44), D68 (= D64), V69 (≠ I65), N95 (≠ S91), A96 (= A92), G97 (= G93), I145 (= I142), Y160 (= Y157), K164 (= K161), P190 (= P187)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 96% coverage: 6:246/250 of query aligns to 3:240/244 of P0A2C9
- M125 (= M131) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (≠ V229) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S230) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
31% identity, 96% coverage: 6:246/250 of query aligns to 3:240/244 of 6t77A
- active site: G16 (= G19), S138 (= S144), Y151 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G15), S14 (≠ A17), R15 (≠ Q18), T37 (≠ M40), L58 (≠ V63), N59 (≠ D64), V60 (≠ I65), A87 (= A92), G88 (= G93), I89 (= I94)
4k6fB X-ray crystal structure of a putative acetoacetyl-coa reductase from burkholderia cenocepacia bound to the co-factor NADP
34% identity, 97% coverage: 9:250/250 of query aligns to 2:245/245 of 4k6fB
- active site: G12 (= G19), N102 (≠ E108), S138 (= S144), Y151 (= Y157), K155 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G15), Y32 (≠ W38), S33 (≠ D39), N36 (≠ E42), V58 (= V63), D59 (= D64), V60 (≠ I65), A87 (= A92), G88 (= G93), I89 (= I94)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 97% coverage: 5:246/250 of query aligns to 2:240/244 of P0AEK2
- GASR 12:15 (≠ GGAQ 15:18) binding
- T37 (≠ M40) binding
- NV 59:60 (≠ DI 64:65) binding
- N86 (≠ S91) binding
- Y151 (= Y157) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSAAK 157:161) binding
- A154 (= A160) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K161) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ A190) binding
- E233 (≠ S239) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
31% identity, 97% coverage: 5:246/250 of query aligns to 1:239/243 of 1q7bA
- active site: G15 (= G19), E101 (= E108), S137 (= S144), Q147 (≠ A154), Y150 (= Y157), K154 (= K161)
- binding calcium ion: E232 (≠ S239), T233 (≠ V240)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (≠ A17), R14 (≠ Q18), T36 (≠ M40), N58 (≠ D64), V59 (≠ I65), N85 (≠ S91), A86 (= A92), G87 (= G93), I88 (= I94), S137 (= S144), Y150 (= Y157), K154 (= K161), P180 (= P187), G181 (≠ A188), I183 (≠ A190)
2q2qD Structure of d-3-hydroxybutyrate dehydrogenase from pseudomonas putida (see paper)
33% identity, 96% coverage: 6:246/250 of query aligns to 2:251/255 of 2q2qD
- active site: G15 (= G19), S138 (= S144), Y151 (= Y157), K155 (= K161), R196 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G11 (= G15), T13 (≠ A17), S14 (≠ Q18), G15 (= G19), I16 (≠ F20), F36 (≠ M40), D59 (= D64), L60 (≠ I65), N86 (≠ S91), G88 (= G93), L109 (≠ I115), I136 (= I142), S138 (= S144), Y151 (= Y157), K155 (= K161), P181 (= P187), G182 (≠ A188), W183 (≠ A189), V184 (≠ A190), T186 (= T192), L188 (≠ I194), V189 (≠ L195)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
30% identity, 97% coverage: 5:246/250 of query aligns to 1:239/243 of 1q7cA
- active site: G15 (= G19), S137 (= S144), Q147 (≠ A154), F150 (≠ Y157), K154 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G15), S13 (≠ A17), R14 (≠ Q18), A35 (≠ D39), T36 (≠ M40), L57 (≠ V63), N58 (≠ D64), V59 (≠ I65), G87 (= G93), I88 (= I94)
5vmlA Crystal structure of acetoacetyl-coa reductase from burkholderia pseudomallei 1710b with bound NADP
33% identity, 95% coverage: 9:246/250 of query aligns to 3:241/245 of 5vmlA
- active site: G13 (= G19), N111 (≠ D116), S139 (= S144), Y152 (= Y157), K156 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G15), G12 (≠ Q18), G13 (= G19), I14 (≠ F20), C33 (vs. gap), G34 (vs. gap), R39 (vs. gap), G59 (= G56), N60 (= N57), V61 (= V58), N87 (≠ S91), G89 (= G93), I90 (= I94), S139 (= S144), Y152 (= Y157), K156 (= K161), P182 (= P187), G183 (≠ A188), I185 (≠ A190)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
30% identity, 98% coverage: 1:246/250 of query aligns to 9:256/261 of 5u9pB
- active site: G27 (= G19), S152 (= S144), Y165 (= Y157), K169 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G15), R26 (≠ Q18), G27 (= G19), I28 (≠ F20), R48 (≠ M40), D73 (= D64), V74 (≠ I65), N100 (≠ S91), A101 (= A92), I150 (= I142), Y165 (= Y157), K169 (= K161), P195 (= P187), F198 (≠ A190), T200 (= T192), L202 (≠ I194), N203 (≠ L195)
5t5qC Crystal structure of short-chain dehydrogenase/reductase sdr:glucose/ribitol dehydrogenase from brucella melitensis
31% identity, 97% coverage: 4:246/250 of query aligns to 3:241/245 of 5t5qC
- active site: G18 (= G19), S140 (= S144), N150 (≠ A154), Y153 (= Y157), K157 (= K161)
- binding nicotinamide-adenine-dinucleotide: N16 (≠ A17), G17 (≠ Q18), G18 (= G19), I19 (≠ F20), D38 (= D39), L39 (≠ M40), D63 (= D64), A64 (≠ I65), S90 (= S91), I113 (= I115), Y153 (= Y157), K157 (= K161), P182 (= P187), I185 (≠ A190), T187 (= T192), M189 (≠ I194)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
34% identity, 96% coverage: 8:246/250 of query aligns to 10:249/258 of 4wecA
- active site: G21 (= G19), S143 (= S144), Q154 (≠ S155), Y157 (= Y157), K161 (= K161)
- binding nicotinamide-adenine-dinucleotide: G17 (= G15), A19 (= A17), S20 (≠ Q18), G21 (= G19), I22 (≠ F20), D41 (= D39), I42 (≠ M40), V61 (= V63), D62 (= D64), V63 (≠ I65), N89 (≠ S91), T141 (≠ I142), Y157 (= Y157), K161 (= K161), P187 (= P187), P189 (≠ A189), V190 (≠ A190)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
31% identity, 97% coverage: 5:246/250 of query aligns to 4:251/255 of 5itvA
- active site: G18 (= G19), S141 (= S144), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G15), S17 (≠ Q18), G18 (= G19), I19 (≠ F20), D38 (= D39), I39 (≠ M40), T61 (≠ V63), I63 (= I65), N89 (≠ S91), G91 (= G93), T139 (≠ I142), S141 (= S144), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (≠ A188), I186 (≠ A189), I187 (≠ A190)
2rh4A Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
33% identity, 96% coverage: 11:250/250 of query aligns to 5:257/257 of 2rh4A
- active site: G13 (= G19), N110 (≠ D116), S140 (= S144), Y153 (= Y157), K157 (= K161), Y198 (vs. gap)
- binding 3-methyl-1,6,8-trihydroxyanthraquinone: T141 (≠ I145), Q145 (≠ E149), V147 (≠ N151), Y153 (= Y157), F185 (vs. gap), L254 (≠ R247)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G15), T11 (≠ A17), S12 (≠ Q18), G13 (= G19), I14 (≠ F20), A33 (≠ D39), R34 (≠ M40), G35 (≠ D41), C58 (≠ V63), D59 (= D64), V60 (≠ I65), N86 (≠ S91), G88 (= G93), S140 (= S144), Y153 (= Y157), K157 (= K161), P183 (vs. gap), G184 (vs. gap), V186 (vs. gap), T188 (= T186), M190 (≠ A188)
2rh4B Actinorhodin ketoreductase, actkr, with NADPH and inhibitor emodin (see paper)
33% identity, 96% coverage: 11:250/250 of query aligns to 16:268/268 of 2rh4B
- active site: G24 (= G19), N121 (≠ D116), S151 (= S144), Y164 (= Y157), K168 (= K161), Y209 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G15), T22 (≠ A17), S23 (≠ Q18), I25 (≠ F20), A44 (≠ D39), R45 (≠ M40), G46 (≠ D41), C69 (≠ V63), D70 (= D64), V71 (≠ I65), N97 (≠ S91), S151 (= S144), Y164 (= Y157), K168 (= K161), G195 (vs. gap), V197 (vs. gap), T199 (= T186), M201 (≠ A188)
Query Sequence
>HSERO_RS06350 FitnessBrowser__HerbieS:HSERO_RS06350
MNHYDFQGRSAIITGGAQGFGYAVAERLLQGKAKVVLWDMDEKALAEARRKLESLGNVET
VKVDISSQAEVQQAIEATEKLTQSIDILVHSAGIAGQNNPVAEYSPEEWRRVIDIDLNGA
FYVNQVVVQRMIAQNYGRIVNIASIAGKEGNPTASAYSAAKAGMIALTKSLGKETATKNI
AVNAITPAAAQTRILEQCTQAHIDYMLSKIPRARFVKVEELAAMVAWLVSEENSFTTASV
FDLSGGRATY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory