Comparing HSERO_RS06545 FitnessBrowser__HerbieS:HSERO_RS06545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
74% identity, 100% coverage: 1:311/311 of query aligns to 1:311/311 of P07773
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
74% identity, 99% coverage: 3:311/311 of query aligns to 1:309/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
74% identity, 99% coverage: 3:311/311 of query aligns to 1:309/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
74% identity, 99% coverage: 3:311/311 of query aligns to 1:309/309 of 1dlmA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
61% identity, 100% coverage: 2:311/311 of query aligns to 1:308/310 of 5umhB
5td3A Crystal structure of catechol 1,2-dioxygenase from burkholderia vietnamiensis
62% identity, 98% coverage: 4:308/311 of query aligns to 2:304/307 of 5td3A
5vxtB Crystal structure of catechol 1,2-dioxygenase from burkholderia ambifaria
60% identity, 100% coverage: 1:311/311 of query aligns to 5:311/312 of 5vxtB
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
55% identity, 98% coverage: 4:308/311 of query aligns to 2:304/309 of 2azqA
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
52% identity, 98% coverage: 8:311/311 of query aligns to 5:309/309 of 2xsrA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
36% identity, 73% coverage: 40:265/311 of query aligns to 7:234/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
36% identity, 73% coverage: 40:265/311 of query aligns to 7:234/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
36% identity, 73% coverage: 40:265/311 of query aligns to 7:234/256 of 3o32A
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
34% identity, 77% coverage: 27:264/311 of query aligns to 2:228/246 of 3th1A
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
32% identity, 85% coverage: 29:292/311 of query aligns to 4:250/253 of 2boyA
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
29% identity, 83% coverage: 27:283/311 of query aligns to 21:272/286 of 3n9tA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
32% identity, 86% coverage: 26:292/311 of query aligns to 28:290/293 of Q5PXQ6
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
32% identity, 86% coverage: 26:292/311 of query aligns to 27:289/292 of 1tmxA
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
36% identity, 59% coverage: 78:262/311 of query aligns to 55:236/258 of 3hgiA
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
36% identity, 59% coverage: 78:262/311 of query aligns to 54:235/257 of 3hj8A
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
36% identity, 59% coverage: 78:262/311 of query aligns to 53:234/256 of 3i51A
>HSERO_RS06545 FitnessBrowser__HerbieS:HSERO_RS06545
MAAKIFSTREVQDFLRLASGLDTEGGNPRTKQIVHRILSDLFKTIEDLEITSDEYWAGVA
YINRLGTAHEAGLLSPGLGLDRFLDMRMDAEDAALGIAGGTPRTIEGPLYVAGAPVEQGF
ARLDDGSDKSGQTIIMHGTVYGADGKPMPGAQVEVWHANTKGFYSHFDPTGEQKPFNMRR
TIITDAQGRYKFRSIMPTAYGCPPAGPTQGLLNALGRHGNRPAHIHFFVTAEGHRKLTTQ
INIEGDPLIYDDFAYATREGLVPPLVERTDAASIKAEGLEGPFAEIVFDIKLTSLVNGAD
NQIVDRPRLAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory