Comparing HSERO_RS06555 FitnessBrowser__HerbieS:HSERO_RS06555 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
2gbxD Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
25% identity, 82% coverage: 17:150/164 of query aligns to 19:156/170 of 2gbxD
>HSERO_RS06555 FitnessBrowser__HerbieS:HSERO_RS06555
MSQSTSLNAICAFLYREARYLDERQWEQWLELYAPDVEYWMPAWDDDDQITEDPQREISL
MYYANRDGLEDRVFRIKTERSSASMPEPRTSHMIANVEVLDEQGDVVEVRYNFHTLSHRY
KITDQFFGTVLATLRKVEGGFVIARKKIVLKNDYIRQVIDVYHV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory