Comparing HSERO_RS06560 FitnessBrowser__HerbieS:HSERO_RS06560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
50% identity, 95% coverage: 2:334/351 of query aligns to 1:337/337 of 1krhA
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
33% identity, 90% coverage: 16:331/351 of query aligns to 10:330/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
33% identity, 90% coverage: 16:331/351 of query aligns to 9:329/333 of 5ogxA
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
29% identity, 91% coverage: 12:331/351 of query aligns to 7:325/326 of 4wqmA
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
29% identity, 91% coverage: 12:331/351 of query aligns to 7:325/326 of Q03304
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
30% identity, 66% coverage: 105:334/351 of query aligns to 8:247/250 of 1tvcA
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
30% identity, 89% coverage: 20:331/351 of query aligns to 19:333/334 of 7c3bC
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
30% identity, 89% coverage: 20:331/351 of query aligns to 18:320/321 of 7c3aA
Sites not aligning to the query:
7romA Crystal structure of saccharomyces cerevisiae nadh-cytochrome b5 reductase 1 (cbr1) fragment (residues 28-284) bound to fad
31% identity, 50% coverage: 139:314/351 of query aligns to 45:232/255 of 7romA
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 89% coverage: 20:331/351 of query aligns to 18:305/306 of 7c3bB
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
25% identity, 58% coverage: 123:327/351 of query aligns to 29:241/243 of 2eixA
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
25% identity, 56% coverage: 136:331/351 of query aligns to 183:390/396 of 1gvhA
Sites not aligning to the query:
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
25% identity, 56% coverage: 136:331/351 of query aligns to 183:390/396 of P24232
Sites not aligning to the query:
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 61% coverage: 111:323/351 of query aligns to 51:275/281 of Q9ZNT1
Sites not aligning to the query:
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 44% coverage: 176:331/351 of query aligns to 116:279/279 of 7qu0A
Sites not aligning to the query:
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
25% identity, 44% coverage: 176:331/351 of query aligns to 116:279/279 of 7qtyA
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
28% identity, 58% coverage: 130:331/351 of query aligns to 25:235/237 of 4eh1A
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
24% identity, 44% coverage: 176:331/351 of query aligns to 125:288/289 of 2r6hC
Sites not aligning to the query:
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
27% identity, 51% coverage: 153:332/351 of query aligns to 88:292/306 of 2rc6A
Sites not aligning to the query:
2rc5A Refined structure of fnr from leptospira interrogans (see paper)
27% identity, 51% coverage: 153:332/351 of query aligns to 88:292/306 of 2rc5A
Sites not aligning to the query:
>HSERO_RS06560 FitnessBrowser__HerbieS:HSERO_RS06560
MSSYRIALNFEDGVTRIIDCGAKEKVLDAAFRNRINLPMDCSDGVCGTCKCRAESGLYDL
GDDYIDDALSSDEAGAGMVLTCQMVPQSDCVIAVPVASTACKTGTASFTGKVAGLSDLGG
AAFELVLEAPANAPAFLPGQYVNIGVPGSGQHRSYSFSSPSGASRMSFLIKNVPGGLMSN
WLAGASEGATLELTGPLGSFYLRPVKRPVLMLAGGTGLAPFLSMLEELAQQGLDQPVHLI
YGVTRDQDLVLVERLQALADRLPGFSFTTCVADPATTHARQGYVTQHMPAAVLHDGNVDV
YLCGPPPMVEAVQKHFQATGMQPASFYYEKFASSQPAVASASAAAAAAAAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory