Comparing HSERO_RS06570 FitnessBrowser__HerbieS:HSERO_RS06570 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
45% identity, 68% coverage: 21:114/138 of query aligns to 16:109/124 of 3k0tC
Sites not aligning to the query:
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
33% identity, 68% coverage: 21:114/138 of query aligns to 19:113/128 of A0A1J1DL12
Sites not aligning to the query:
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
36% identity, 78% coverage: 21:128/138 of query aligns to 16:122/126 of 2b33B
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
33% identity, 78% coverage: 21:128/138 of query aligns to 18:125/127 of 5v4dA
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
34% identity, 81% coverage: 21:132/138 of query aligns to 21:131/137 of P52759
Sites not aligning to the query:
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
33% identity, 59% coverage: 21:102/138 of query aligns to 16:99/124 of 7cd4A
Sites not aligning to the query:
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
31% identity, 78% coverage: 21:128/138 of query aligns to 21:127/137 of P80601
Sites not aligning to the query:
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
31% identity, 78% coverage: 21:128/138 of query aligns to 16:125/127 of 3vczB
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
27% identity, 59% coverage: 21:101/138 of query aligns to 16:97/127 of 2uynA
Sites not aligning to the query:
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
27% identity, 59% coverage: 21:101/138 of query aligns to 16:97/127 of 2uykC
Sites not aligning to the query:
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
25% identity, 92% coverage: 4:130/138 of query aligns to 3:126/128 of P0AFQ5
>HSERO_RS06570 FitnessBrowser__HerbieS:HSERO_RS06570
MSDRQAIIPKGMEDVYEKIGYAPAVRVGQVLYVSGQIGRGPDMQLVEPREAQIVQAFENL
KLVLATAGGTLDDIVDLTTFHTDMRDLPLFIKVRNRYLSHYPLPAWTAIGAHMLGGAPGY
VIEIKAVAHLRPAGGGAS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory