SitesBLAST
Comparing HSERO_RS06965 FitnessBrowser__HerbieS:HSERO_RS06965 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
38% identity, 90% coverage: 39:419/422 of query aligns to 44:436/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
38% identity, 90% coverage: 39:419/422 of query aligns to 6:398/433 of 8gy2B
- binding heme c: C18 (= C51), C21 (= C54), H22 (= H55), T46 (≠ S79), I48 (= I81), Y59 (≠ W92), L68 (= L101), R73 (≠ G106), V79 (≠ L112), Y80 (= Y113), M83 (≠ F116), F88 (≠ Y121), R126 (= R158), H165 (= H196), C166 (= C197), C169 (= C200), H170 (= H201), I201 (≠ Y227), A202 (= A228), P203 (= P229), L205 (= L231), W216 (= W241), F224 (≠ L249), A234 (≠ V259), V235 (≠ T260), F236 (≠ L261), F236 (≠ L261), M239 (= M264), N301 (≠ L323), C302 (= C324), C305 (= C327), H306 (= H328), M316 (≠ D338), F317 (≠ Y339), P318 (= P340), L320 (= L342), P324 (≠ R346), G342 (= G364), S352 (≠ Y374), V354 (≠ F376), M356 (= M378), F359 (= F381), M375 (≠ V397)
- binding ubiquinone-10: C21 (= C54), L34 (≠ R67), P39 (= P72), P81 (= P114), L129 (= L161), W132 (= W164), E168 (≠ A199), R173 (= R204), I197 (≠ A223), D241 (≠ E266)
Sites not aligning to the query:
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 91% coverage: 39:421/422 of query aligns to 1:394/418 of 7w2jC
- binding heme c: C13 (= C51), C16 (= C54), H17 (= H55), T42 (≠ S79), I44 (= I81), Y55 (≠ W92), L75 (= L112), Y76 (= Y113), A78 (= A115), M79 (≠ F116), R122 (= R158), H161 (= H196), C162 (= C197), C165 (= C200), H166 (= H201), A191 (= A228), P192 (= P229), R223 (≠ V259), P227 (= P263), M228 (= M264), V289 (≠ L323), C290 (= C324), C293 (= C327), H294 (= H328), Y305 (vs. gap), Y306 (= Y339), P307 (= P340), L309 (= L342), N312 (= N345), T313 (≠ R346), T314 (≠ A347), D322 (≠ N355), I327 (≠ V360), V331 (≠ P367), R333 (≠ T369), I340 (≠ F376), M342 (= M378), P343 (= P379), F345 (= F381)
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
38% identity, 91% coverage: 39:421/422 of query aligns to 1:408/413 of 8jejC
- binding heme c: C13 (= C51), C16 (= C54), H17 (= H55), T42 (≠ S79), I44 (= I81), F60 (= F97), L64 (= L101), L75 (= L112), Y76 (= Y113), M79 (≠ F116), P80 (= P117), Y84 (= Y121), R122 (= R158), C162 (= C197), C165 (= C200), H166 (= H201), I186 (= I221), W189 (= W226), A191 (= A228), P192 (= P229), I194 (≠ L231), W205 (= W241), Y213 (≠ L249), R223 (≠ V259), M228 (= M264), V303 (≠ L323), C304 (= C324), C307 (= C327), H308 (= H328), Y320 (= Y339), P321 (= P340), L323 (= L342), T327 (≠ R346), T328 (≠ A347), D336 (≠ N355), I341 (≠ V360), V345 (≠ P367), R347 (≠ T369), I354 (≠ F376), M356 (= M378), F359 (= F381), I376 (≠ V393)
- binding ubiquinone-10: M36 (≠ F73), P77 (= P114), S124 (≠ L160), W128 (= W164), C165 (= C200), L173 (≠ G208), L408 (= L421)
Sites not aligning to the query:
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
36% identity, 94% coverage: 4:400/422 of query aligns to 1:410/440 of 8gy3A
- binding heme c: Y52 (≠ N50), C53 (= C51), C56 (= C54), H57 (= H55), S84 (= S79), I86 (= I81), W97 (= W92), F102 (= F97), L117 (= L112), F121 (= F116), F126 (≠ Y121), R163 (= R158), C203 (= C197), C206 (= C200), H207 (= H201), A232 (= A228), P233 (= P229), L235 (= L231), W245 (= W241), Y253 (≠ L249), L254 (= L250), G263 (≠ A258), S264 (≠ V259), M269 (= M264), Y292 (≠ L287), C337 (= C324), C340 (= C327), H341 (= H328), P353 (= P340), L355 (= L342), N358 (= N345), N359 (≠ R346), V372 (≠ A359), I377 (≠ P366), G382 (= G371), Q383 (≠ N372), I386 (≠ F376), M388 (= M378), F391 (= F381)
- binding ubiquinone-10: E55 (≠ A53), T76 (≠ S71), F78 (= F73), Y118 (= Y113), P119 (= P114), I160 (≠ Y155), G166 (vs. gap), Q167 (≠ L161), F169 (≠ L163), W170 (= W164), H202 (= H196), R210 (= R204), L213 (= L207)
6fjaA Crystal structure of t2d three-domain heme-cu nitrite reductase from ralstonia pickettii
37% identity, 32% coverage: 284:420/422 of query aligns to 317:455/455 of 6fjaA
- binding protoporphyrin ix containing fe: T359 (≠ L323), C360 (= C324), C363 (= C327), H364 (= H328), P376 (= P340), P377 (= P341), L378 (= L342), F383 (≠ A347), N400 (≠ G364), G401 (≠ F365), Y410 (= Y374), S412 (≠ F376), M414 (= M378), M417 (≠ F381)
Sites not aligning to the query:
- active site: 90, 93, 95, 130, 131, 139, 144, 236, 258, 259, 285
- binding copper (ii) ion: 90, 131, 139, 144
5oboA Crystal structure of nitrite bound d97n mutant of three-domain heme-cu nitrite reductase from ralstonia pickettii
37% identity, 32% coverage: 284:420/422 of query aligns to 318:456/456 of 5oboA
- binding heme c: T360 (≠ L323), C361 (= C324), C364 (= C327), H365 (= H328), P377 (= P340), P378 (= P341), L379 (= L342), S382 (≠ N345), F384 (≠ A347), I395 (≠ A359), N401 (≠ G364), G402 (≠ F365), S413 (≠ F376), M415 (= M378), M418 (≠ F381)
Sites not aligning to the query:
- active site: 91, 94, 96, 131, 132, 140, 145, 237, 259, 260, 286
- binding copper (ii) ion: 91, 96, 131, 132, 140, 145
- binding nitrite ion: 94, 96, 131
4ax3D Structure of three-domain heme-cu nitrite reductase from ralstonia pickettii at 1.6 a resolution (see paper)
37% identity, 32% coverage: 284:418/422 of query aligns to 320:456/457 of 4ax3D
- binding heme c: C363 (= C324), C366 (= C327), H367 (= H328), P379 (= P340), P380 (= P341), L381 (= L342), S384 (≠ N345), F386 (≠ A347), N403 (≠ G364), G404 (≠ F365), S415 (≠ F376), M417 (= M378), M420 (≠ F381)
Sites not aligning to the query:
- active site: 93, 96, 98, 133, 134, 142, 147, 239, 261, 262, 288
- binding copper (ii) ion: 93, 98, 133, 134, 142, 147
2zooA Crystal structure of nitrite reductase from pseudoalteromonas haloplanktis tac125
31% identity, 32% coverage: 281:417/422 of query aligns to 305:438/438 of 2zooA
- binding protoporphyrin ix containing fe: C347 (= C324), C350 (= C327), H351 (= H328), F362 (≠ Y339), P363 (= P340), P364 (= P341), L365 (= L342), S368 (≠ N345), Y370 (≠ A347), I382 (≠ V360), L386 (≠ G364), S387 (≠ F365), G388 (≠ P366), I390 (≠ S368), V392 (≠ A370), Y397 (≠ P375), N398 (≠ F376), G399 (= G377), V400 (≠ M378), M401 (≠ P379)
Sites not aligning to the query:
- active site: 81, 84, 86, 121, 122, 130, 135, 227, 249, 250, 276
- binding copper (ii) ion: 81, 86, 121, 122, 130, 135
8hddB Complex structure of catalytic, small, and a partial electron transfer subunits from burkholderia cepacia fad glucose dehydrogenase
33% identity, 24% coverage: 318:417/422 of query aligns to 24:121/121 of 8hddB
- binding protoporphyrin ix containing fe: C30 (= C324), C33 (= C327), H34 (= H328), Y46 (= Y339), P47 (= P340), T54 (≠ A347), V66 (≠ A359), I67 (≠ V360), R73 (≠ T369), I80 (≠ F376), M82 (= M378), P83 (= P379)
Query Sequence
>HSERO_RS06965 FitnessBrowser__HerbieS:HSERO_RS06965
LGVLAALLIALPAAVIGWQWLGPEERGAATPAPDPTRQLAQGQYLARAGNCMACHTARGG
APYAGGRAIASPFGTLYTSNITPDKTTGIGQWSADDFWRALHHGRGKEGQFLYPAFPYTS
YTRLSRADSDALFAYLQSLPPVARANQAHTLRFPYDQRMLLGLWRALYFTPQSYQPDPRQ
DAQWNRGAYLVQGAGHCSACHSARNRLGASIEPLALAGGVIPALQWYAPPLHGGADGLQD
WSTADIAALLKTGVSPHAVTLGPMSEIVGRSLQYLNDADVSAMAVYLKSLPASAADDAAR
PASVEPAEAERIMKQGKQLYGTLCVDCHGGKGQGSAPDYPPLAGNRAIAGPHPANAVRAV
LNGGFPPSTAGNPYPFGMPPFGPQLSDQEVAAVVSYVRNSWGNQGGLVSAAEVNRYRSVP
LD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory