Comparing HSERO_RS07080 FitnessBrowser__HerbieS:HSERO_RS07080 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
32% identity, 97% coverage: 1:505/522 of query aligns to 1:487/501 of P04983
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 41% coverage: 13:224/522 of query aligns to 11:221/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 41% coverage: 13:224/522 of query aligns to 11:221/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 41% coverage: 13:224/522 of query aligns to 11:221/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 41% coverage: 13:224/522 of query aligns to 11:221/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 40% coverage: 13:220/522 of query aligns to 9:215/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 41% coverage: 6:220/522 of query aligns to 2:207/348 of 3d31A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 43% coverage: 6:227/522 of query aligns to 3:222/241 of 4u00A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 40% coverage: 17:227/522 of query aligns to 17:227/343 of P30750
Sites not aligning to the query:
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 40% coverage: 17:227/522 of query aligns to 18:234/265 of P07821
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 40% coverage: 17:227/522 of query aligns to 18:228/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 40% coverage: 17:227/522 of query aligns to 18:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 40% coverage: 17:227/522 of query aligns to 18:228/344 of 3tuiC
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 43% coverage: 10:234/522 of query aligns to 9:243/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 43% coverage: 10:234/522 of query aligns to 9:243/253 of 1g9xB
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
35% identity, 38% coverage: 21:220/522 of query aligns to 625:821/860 of A0R6H8
Sites not aligning to the query:
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
26% identity, 44% coverage: 4:231/522 of query aligns to 5:221/353 of 1vciA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 44% coverage: 13:240/522 of query aligns to 10:231/240 of 6mjpA
G7CBF5 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
34% identity, 38% coverage: 23:220/522 of query aligns to 672:866/908 of G7CBF5
Sites not aligning to the query:
7w79A Heme exporter hrtba in complex with mn-amppnp (see paper)
32% identity, 41% coverage: 6:218/522 of query aligns to 5:214/216 of 7w79A
>HSERO_RS07080 FitnessBrowser__HerbieS:HSERO_RS07080
MHALELEIINAGKSFGSFRALDEVSLKIRAGTIHALLGENGAGKSTLVKGLVGYSPLDQG
SILADRREVDIRSARVPNQLGIGMVYQHFTLAPSLTVAENLLLARGDLPWRIRWSSERAV
LEEFMAKMPFKLSPERTVSSLSAGEKQKLEILKQLYLRRRFLILDEPTSVLTPQEADEVL
GLMHALTRQQELTVLMITHKFHEVSAYADDVTVLRKGRLVGSARVAETSPDMLAHWMMGQ
ARAEKAQVARPAVPVQASVGLEVRDLTVNNDRGVAAVRALSLQVRRGEIVGLAGISGNGQ
KELVEALLGQRRLLLGEIRVEGAPYAATREEMRRLRVFALPEEPLRNACIAGMSVAENMA
LRNFDVAPFKRGGWRIDRSAMKRQAQALISAFNVKPPVPERPIGTLSGGNVQRAVLAREL
GEDGQDGAANVLIVANPVFGLDFASVADIHARLLQARARGAAVLLVSEDLDELLELSDRI
LVMTEGRIVHVAQDVAKEGADRAALGRWMAGHAQQSTHAEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory