Comparing HSERO_RS07335 FitnessBrowser__HerbieS:HSERO_RS07335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
7t5aA Crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in tungstate-bound form (see paper)
25% identity, 88% coverage: 28:258/262 of query aligns to 2:229/230 of 7t5aA
7t51A Crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in molybdate-bound form (see paper)
25% identity, 87% coverage: 30:258/262 of query aligns to 1:226/227 of 7t51A
7t50A Crystal structure of the molybdate-binding periplasmic protein moda from the bacteria pseudomonsa aeruginosa in chromate-bound form (see paper)
25% identity, 87% coverage: 30:258/262 of query aligns to 1:226/227 of 7t50A
>HSERO_RS07335 FitnessBrowser__HerbieS:HSERO_RS07335
MKSLLSSKPLQRSVLALLIGATSALAAATDIHVVSSGGFAAAYKTLAPEFEKKTGHKLIS
GWGPSMGETPQAIPNRLQRGEHIDVVIMVGDSLDKLVAAGKVSKTEHKLLALSRIGLAVK
AGAPRPDISNLDAFKRTLLTAHSVVYSDSASGVFLSTKLFKRLGIDQQMAYKGRMIPAEP
VGQVVARGDAEIGLQQISELKPVKGIDIIGPIPEEAQQLTPFSAGVVVGAHEAEAAKELV
HFLASPEAQAAIKASGLDPAPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory