SitesBLAST
Comparing HSERO_RS07425 FitnessBrowser__HerbieS:HSERO_RS07425 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6vw7D Formate dehydrogenase fdsabg subcomplex fdsbg from c. Necator - nadh bound (see paper)
77% identity, 98% coverage: 8:516/520 of query aligns to 6:514/514 of 6vw7D
- binding flavin mononucleotide: G154 (= G156), G156 (= G158), K165 (= K167), N182 (= N184), E185 (= E187), G273 (= G275), E274 (= E276), E275 (= E277), N309 (= N311), N310 (= N312), S313 (= S315), A490 (= A492), M491 (= M493)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A158 (= A160), F160 (= F162), K165 (= K167), T168 (= T170), E275 (= E277), L295 (= L297)
- binding iron/sulfur cluster: V271 (≠ I273), V289 (= V291), S442 (= S444), C443 (= C445), G444 (= G446), K445 (= K447), C446 (= C448), C449 (= C451), L488 (= L490), C489 (= C491), M491 (= M493), G492 (= G494)
6tg9B Cryo-em structure of nadh reduced form of NAD+-dependent formate dehydrogenase from rhodobacter capsulatus (see paper)
60% identity, 97% coverage: 7:512/520 of query aligns to 1:492/493 of 6tg9B
- binding flavin mononucleotide: G146 (= G156), R147 (= R157), G148 (= G158), N174 (= N184), D176 (= D186), E177 (= E187), Y254 (= Y272), G257 (= G275), E258 (= E276), N293 (= N311), N294 (= N312), S297 (= S315)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F152 (= F162), K157 (= K167), E258 (= E276), E259 (= E277), L279 (= L297), K466 (≠ V486), L470 (= L490)
- binding iron/sulfur cluster: S426 (= S444), C427 (= C445), G428 (= G446), T429 (≠ K447), C430 (= C448), C433 (= C451), L470 (= L490), C471 (= C491), G474 (= G494)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
42% identity, 96% coverage: 15:514/520 of query aligns to 9:511/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ T16), C41 (≠ S47), C45 (≠ F51)
- binding flavin mononucleotide: R154 (= R157), K164 (= K167), N181 (= N184), F269 (≠ Y272), E273 (= E276), E274 (= E277), I307 (= I310), N308 (= N311), N309 (= N312), G489 (≠ A492), L490 (≠ M493)
- binding nicotinamide-adenine-dinucleotide: G155 (= G158), G156 (= G159), F159 (= F162), F163 (≠ I166), E273 (= E276), E274 (= E277), K291 (= K294), F294 (≠ L297), G413 (= G416)
- binding iron/sulfur cluster: P288 (≠ V291), C442 (= C445), G443 (= G446), C445 (= C448), C448 (= C451), C488 (= C491), L490 (≠ M493), G491 (= G494)
- binding zinc ion: C425 (≠ D428)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
40% identity, 95% coverage: 21:514/520 of query aligns to 56:557/630 of 8a6tB
- binding fe2/s2 (inorganic) cluster: C82 (≠ S47), F85 (≠ M50), C86 (≠ F51)
- binding flavin mononucleotide: G201 (= G158), N227 (= N184), E230 (= E187), N355 (= N312), G535 (≠ A492), L536 (≠ M493)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E277), R337 (≠ K294), R340 (≠ L297), T341 (≠ P298), N342 (≠ A299), S433 (≠ L390)
- binding iron/sulfur cluster: S487 (= S444), C488 (= C445), G489 (= G446), C491 (= C448), C494 (= C451), C534 (= C491), L536 (≠ M493), G537 (= G494)
- binding zinc ion: C471 (≠ D428)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
42% identity, 97% coverage: 7:512/520 of query aligns to 26:541/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (≠ P12), G33 (≠ D14), T34 (≠ S15), C36 (≠ A17), C67 (≠ S47), C68 (≠ R48), G69 (= G49), R70 (≠ M50), C71 (≠ F51)
- binding flavin mononucleotide: G185 (= G156), R186 (= R157), G187 (= G158), N213 (= N184), D215 (= D186), E216 (= E187), G217 (= G188), F301 (≠ Y272), G304 (= G275), E305 (= E276), E306 (= E277), N340 (= N311), N341 (= N312), G521 (≠ A492), L522 (≠ M493)
- binding iron/sulfur cluster: P320 (≠ V291), S473 (= S444), C474 (= C445), G475 (= G446), K476 (= K447), C477 (= C448), C480 (= C451), L519 (= L490), C520 (= C491), L522 (≠ M493), G523 (= G494)
- binding zinc ion: C457 (≠ D428)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
41% identity, 93% coverage: 34:514/520 of query aligns to 35:526/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C48 (≠ S47), F49 (≠ R48), L51 (≠ M50), C52 (≠ F51)
- binding flavin mononucleotide: G166 (= G156), G168 (= G158), N196 (= N184), D198 (= D186), F284 (≠ Y272), G287 (= G275), E288 (= E276), E289 (= E277), N324 (= N312)
- binding iron/sulfur cluster: C457 (= C445), G458 (= G446), K459 (= K447), C460 (= C448), C463 (= C451), C503 (= C491), G506 (= G494)
- binding zinc ion: C440 (≠ D428)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
45% identity, 79% coverage: 105:514/520 of query aligns to 2:412/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D428), C364 (≠ I466)
- binding flavin mononucleotide: G54 (= G156), G56 (= G158), K65 (= K167), N82 (= N184), D84 (= D186), E85 (= E187), G173 (= G275), E175 (= E277), N210 (= N312), G390 (≠ A492), L391 (≠ M493)
- binding nicotinamide-adenine-dinucleotide: G56 (= G158), G57 (= G159), A58 (= A160), F60 (= F162), K65 (= K167), F68 (≠ T170), E85 (= E187), E175 (= E277), R192 (≠ K294), F195 (≠ L297), I312 (≠ M414), M313 (≠ I415), S315 (≠ H417)
- binding iron/sulfur cluster: S342 (= S444), C343 (= C445), G344 (= G446), C346 (= C448), C349 (= C451), S387 (= S489), C389 (= C491), L391 (≠ M493), G392 (= G494)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
45% identity, 79% coverage: 105:514/520 of query aligns to 2:412/425 of 7t2rB
Sites not aligning to the query:
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
45% identity, 76% coverage: 121:514/520 of query aligns to 1:397/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G156), G39 (= G158), N67 (= N184), G158 (= G275), E159 (= E276), E160 (= E277), G375 (≠ A492)
- binding nicotinamide-adenine-dinucleotide: G40 (= G159), F43 (= F162), K48 (= K167), R177 (≠ K294), F180 (≠ L297), M297 (= M414)
- binding iron/sulfur cluster: S327 (= S444), C328 (= C445), G329 (= G446), K330 (= K447), C331 (= C448), C334 (= C451), L373 (= L490), C374 (= C491)
- binding zinc ion: C311 (≠ D428)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
44% identity, 78% coverage: 107:512/520 of query aligns to 13:420/437 of 4hea1
- binding flavin mononucleotide: G63 (= G156), K74 (= K167), N91 (= N184), D93 (= D186), Y179 (= Y272), G182 (= G275), E183 (= E276), N218 (= N311), N219 (= N312), L401 (≠ M493)
- binding iron/sulfur cluster: I180 (= I273), P198 (≠ V291), S351 (= S444), C352 (= C445), G353 (= G446), K354 (= K447), C355 (= C448), C358 (= C451), F398 (≠ L490), C399 (= C491), L401 (≠ M493)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
44% identity, 78% coverage: 107:512/520 of query aligns to 13:420/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G156), G65 (= G158), N91 (= N184), D93 (= D186), G182 (= G275), E183 (= E276), E184 (= E277), N218 (= N311), N219 (= N312), T222 (≠ S315), P400 (≠ A492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G158), G66 (= G159), F69 (= F162), K74 (= K167), F77 (≠ T170), E96 (≠ D189), Y179 (= Y272), E184 (= E277), K201 (= K294), F204 (≠ L297), T324 (≠ H417)
- binding iron/sulfur cluster: S351 (= S444), C352 (= C445), K354 (= K447), C355 (= C448), C358 (= C451), F398 (≠ L490), C399 (= C491), L401 (≠ M493), A402 (≠ G494)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
44% identity, 78% coverage: 107:512/520 of query aligns to 14:421/438 of Q56222
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
47% identity, 71% coverage: 145:514/520 of query aligns to 3:374/447 of 8a5eB
- binding flavin mononucleotide: G14 (= G156), G16 (= G158), N44 (= N184), G135 (= G275), E137 (= E277), N171 (= N311), N172 (= N312), G352 (≠ A492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G158), G17 (= G159), F20 (= F162), K25 (= K167), F28 (≠ T170), D49 (= D189), R154 (≠ K294), F157 (≠ L297), S250 (≠ L390)
- binding iron/sulfur cluster: P151 (≠ V291), C305 (= C445), G306 (= G446), K307 (= K447), C308 (= C448), C311 (= C451), C351 (= C491), G354 (= G494)
- binding zinc ion: C288 (≠ D428)
Sites not aligning to the query:
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
40% identity, 77% coverage: 119:518/520 of query aligns to 23:425/442 of 7p61F
- binding flavin mononucleotide: G61 (= G156), G63 (= G158), K72 (= K167), N90 (= N184), D92 (= D186), G181 (= G275), E182 (= E276), N217 (= N311), N218 (= N312), A399 (= A492), H400 (≠ M493)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G158), G64 (= G159), A65 (= A160), F67 (= F162), K72 (= K167), L75 (≠ T170), E95 (≠ D189), Y178 (= Y272), E183 (= E277), F203 (≠ L297), R320 (≠ M414), T323 (≠ H417)
- binding iron/sulfur cluster: S350 (= S444), C351 (= C445), W353 (≠ K447), C354 (= C448), C357 (= C451), F397 (≠ L490), C398 (= C491), H400 (≠ M493)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
41% identity, 76% coverage: 118:514/520 of query aligns to 15:419/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G156), R54 (= R157), G55 (= G158), A57 (= A160), K64 (= K167), N90 (= N184), D92 (= D186), Y178 (= Y272), G181 (= G275), E182 (= E276), E183 (= E277), N217 (= N311), N218 (= N312), S221 (= S315), L398 (≠ M493)
- binding iron/sulfur cluster: P197 (≠ V291), S349 (= S444), C350 (= C445), G351 (= G446), K352 (= K447), C353 (= C448), C356 (= C451), S394 (= S489), F395 (≠ L490), C396 (= C491), L398 (≠ M493), G399 (= G494)
- binding zinc ion: C333 (≠ D428), E371 (≠ I466)
Sites not aligning to the query:
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
39% identity, 75% coverage: 121:512/520 of query aligns to 29:413/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G156), G66 (= G158), K75 (= K167), N91 (= N184), D93 (= D186), E94 (= E187), G182 (= G275), E183 (= E276), E184 (= E277), V217 (≠ I310), N218 (= N311), N219 (= N312), T222 (≠ S315), G393 (≠ A492)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G158), G67 (= G159), A68 (= A160), F70 (= F162), K75 (= K167), E94 (= E187), E96 (≠ D189), Y179 (= Y272), E184 (= E277), Y204 (≠ L297)
- binding iron/sulfur cluster: P198 (≠ V291), T345 (≠ S444), C346 (= C445), G347 (= G446), Q348 (≠ K447), C349 (= C448), C352 (= C451), I391 (≠ L490), C392 (= C491), L394 (≠ M493), G395 (= G494)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
39% identity, 75% coverage: 121:512/520 of query aligns to 28:412/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G156), G65 (= G158), K74 (= K167), N90 (= N184), D92 (= D186), E93 (= E187), G181 (= G275), E182 (= E276), E183 (= E277), V216 (≠ I310), N217 (= N311), N218 (= N312), T221 (≠ S315)
- binding nicotinamide-adenine-dinucleotide: G65 (= G158), G66 (= G159), A67 (= A160), F69 (= F162), K74 (= K167), E95 (≠ D189), Y178 (= Y272), E183 (= E277), K200 (= K294), Y203 (≠ L297)
- binding iron/sulfur cluster: I179 (= I273), P197 (≠ V291), T344 (≠ S444), C345 (= C445), G346 (= G446), Q347 (≠ K447), C348 (= C448), C351 (= C451), S389 (= S489), I390 (≠ L490), C391 (= C491), L393 (≠ M493), G394 (= G494)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
39% identity, 75% coverage: 121:512/520 of query aligns to 29:413/419 of 6saqB
- binding flavin mononucleotide: G64 (= G156), G66 (= G158), K75 (= K167), N91 (= N184), D93 (= D186), E94 (= E187), Y179 (= Y272), G182 (= G275), E183 (= E276), N218 (= N311), N219 (= N312), T222 (≠ S315)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G158), G67 (= G159), A68 (= A160), F70 (= F162), K75 (= K167), E94 (= E187), E96 (≠ D189), T99 (= T192), E184 (= E277), Y204 (≠ L297), T318 (≠ H417)
- binding iron/sulfur cluster: P198 (≠ V291), T345 (≠ S444), C346 (= C445), G347 (= G446), Q348 (≠ K447), C349 (= C448), C352 (= C451), I391 (≠ L490), C392 (= C491), G395 (= G494)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
39% identity, 75% coverage: 121:512/520 of query aligns to 30:414/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G156), G67 (= G158), K76 (= K167), N92 (= N184), E95 (= E187), Y180 (= Y272), G183 (= G275), E184 (= E276), V218 (≠ I310), N219 (= N311), N220 (= N312), T223 (≠ S315)
- binding iron/sulfur cluster: T346 (≠ S444), C347 (= C445), G348 (= G446), Q349 (≠ K447), C350 (= C448), C353 (= C451), S391 (= S489), I392 (≠ L490), C393 (= C491), G396 (= G494)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
37% identity, 78% coverage: 103:510/520 of query aligns to 7:420/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G156), G61 (= G158), K70 (= K167), N91 (= N184), D93 (= D186), G182 (= G275), E183 (= E276), E184 (= E277), A218 (≠ N311), N219 (= N312), A401 (= A492), L402 (≠ M493)
- binding iron/sulfur cluster: P198 (≠ V291), C354 (= C445), G355 (= G446), Q356 (≠ K447), C357 (= C448), C360 (= C451), T398 (≠ S489), C400 (= C491), L402 (≠ M493)
Query Sequence
>HSERO_RS07425 FitnessBrowser__HerbieS:HSERO_RS07425
MSANDTVTVYVPRDSTALALGANEVAAAITAEAHKRGQSIKLVRNGSRGMFWLEPLVEVA
TAAGRVAYGPVAPEDVAGLFDAGLLQGGQHALHLGLTEEIAFLKNQERLTFARVGIIDPL
SLEDYLAHEGYVGLKNALAKTPEAIVQEMIASGLRGRGGAAFPTGIKWQTVLRAQSAQKY
VVCNADEGDSGTFSDRMIMEDDPFTLIEGMTIAGVAVGATEGYIYVRSEYPHSIATLEQA
IAIAHAQGYLGDDILGSGKSFRLEVRKGAGAYICGEETAMLESLEGKRGVVRAKPPLPAI
EGLFGKPTVINNLISLASVPVILARGADFYKNFGVGRSHGTLPFQLAGNIRQGGLVEKAF
GLTLRQLLEDFGGGSASGRPIRAVQMGGPLGAYLPQSQFDTPLDYEAFAAIGAMIGHGGL
VAFDDSVDMARQARYAMQFCAVESCGKCTPCRIGSTRGVEVIDKIIANDDRAQQIHLLKS
LCDTMVNGSLCAMGGMTPFPVLSALNHFPEDFGAPSEQAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory