SitesBLAST
Comparing HSERO_RS07480 FitnessBrowser__HerbieS:HSERO_RS07480 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
48% identity, 85% coverage: 22:245/265 of query aligns to 23:248/256 of 8w9mC
- binding adenosine-5'-triphosphate: S42 (= S41), G43 (= G42), G45 (= G44), K46 (= K45), S47 (= S46), T48 (= T47), Q83 (= Q81), K132 (= K129), E136 (= E133), S138 (= S135), G140 (= G137), H195 (= H192)
- binding magnesium ion: S47 (= S46), Q83 (= Q81)
Sites not aligning to the query:
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
48% identity, 85% coverage: 22:245/265 of query aligns to 23:248/658 of 8wm7C
Sites not aligning to the query:
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
49% identity, 80% coverage: 17:228/265 of query aligns to 19:232/257 of 8wm7D
Sites not aligning to the query:
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
48% identity, 80% coverage: 17:228/265 of query aligns to 17:230/256 of 8w9mD
- binding adenosine-5'-triphosphate: H40 (≠ P40), S41 (= S41), G42 (= G42), G44 (= G44), K45 (= K45), S46 (= S46), T47 (= T47), Q82 (= Q81), Q135 (≠ E133), S137 (= S135), G139 (= G137), M140 (= M138), H194 (= H192)
- binding magnesium ion: S46 (= S46), Q82 (= Q81)
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
45% identity, 84% coverage: 5:227/265 of query aligns to 1:227/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ I16), S37 (= S41), G38 (= G42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), Q81 (= Q81), R128 (≠ K129), A132 (≠ E133), S134 (= S135), G136 (= G137), Q137 (≠ M138), E158 (= E159), H191 (= H192)
- binding magnesium ion: S42 (= S46), Q81 (= Q81)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
45% identity, 84% coverage: 5:227/265 of query aligns to 1:227/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ I16), G38 (= G42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (≠ K129), S134 (= S135), Q137 (≠ M138)
- binding beryllium trifluoride ion: S37 (= S41), G38 (= G42), K41 (= K45), Q81 (= Q81), S134 (= S135), G136 (= G137), H191 (= H192)
- binding magnesium ion: S42 (= S46), Q81 (= Q81)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
45% identity, 84% coverage: 5:227/265 of query aligns to 1:227/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ I16), V17 (≠ I21), G38 (= G42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (≠ K129), A132 (≠ E133), S134 (= S135), Q137 (≠ M138)
- binding tetrafluoroaluminate ion: S37 (= S41), G38 (= G42), K41 (= K45), Q81 (= Q81), S134 (= S135), G135 (= G136), G136 (= G137), E158 (= E159), H191 (= H192)
- binding magnesium ion: S42 (= S46), Q81 (= Q81)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
45% identity, 84% coverage: 5:227/265 of query aligns to 1:227/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ I16), V17 (≠ I21), G38 (= G42), C39 (= C43), G40 (= G44), K41 (= K45), S42 (= S46), T43 (= T47), R128 (≠ K129), A132 (≠ E133), S134 (= S135), Q137 (≠ M138)
- binding magnesium ion: S42 (= S46), Q81 (= Q81)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
45% identity, 84% coverage: 5:227/265 of query aligns to 2:228/371 of P68187
- A85 (= A85) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ A106) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (≠ A114) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ Y117) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ S119) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ K124) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G137) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D158) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
- R228 (= R227) mutation to C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
Sites not aligning to the query:
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 84% coverage: 5:227/265 of query aligns to 1:227/374 of 2awnB
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
45% identity, 83% coverage: 7:227/265 of query aligns to 1:225/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ I16), S35 (= S41), G36 (= G42), C37 (= C43), G38 (= G44), K39 (= K45), S40 (= S46), T41 (= T47), R126 (≠ K129), A130 (≠ E133), S132 (= S135), G134 (= G137), Q135 (≠ M138)
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
43% identity, 84% coverage: 5:227/265 of query aligns to 2:228/369 of P19566
- L86 (= L86) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P160) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D165) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hplC Lpqy-sugabc in state 1 (see paper)
41% identity, 83% coverage: 27:246/265 of query aligns to 22:248/384 of 8hplC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
40% identity, 89% coverage: 27:263/265 of query aligns to 24:272/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S41), G39 (= G42), G41 (= G44), K42 (= K45), S43 (= S46), Q82 (= Q81), Q133 (≠ E133), G136 (= G136), G137 (= G137), Q138 (≠ M138), H192 (= H192)
- binding magnesium ion: S43 (= S46), Q82 (= Q81)
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
40% identity, 89% coverage: 27:263/265 of query aligns to 24:272/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S41), C40 (= C43), G41 (= G44), K42 (= K45), S43 (= S46), T44 (= T47), Q82 (= Q81), R129 (≠ K129), Q133 (≠ E133), S135 (= S135), G136 (= G136), G137 (= G137), Q159 (≠ E159), H192 (= H192)
- binding magnesium ion: S43 (= S46), Q82 (= Q81)
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 75% coverage: 25:222/265 of query aligns to 23:223/393 of P9WQI3
- H193 (= H192) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
2awnC Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
45% identity, 77% coverage: 25:227/265 of query aligns to 14:197/344 of 2awnC
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 72% coverage: 20:210/265 of query aligns to 31:224/378 of P69874
- F45 (= F34) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C43) mutation to T: Loss of ATPase activity and transport.
- L60 (= L49) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V64) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V121) mutation to M: Loss of ATPase activity and transport.
- D172 (= D158) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
34% identity, 98% coverage: 5:264/265 of query aligns to 5:283/375 of 2d62A
1g291 Malk (see paper)
39% identity, 75% coverage: 25:222/265 of query aligns to 22:228/372 of 1g291
- binding magnesium ion: D69 (≠ G71), E71 (vs. gap), K72 (vs. gap), K79 (vs. gap), D80 (vs. gap)
- binding pyrophosphate 2-: S38 (= S41), G39 (= G42), C40 (= C43), G41 (= G44), K42 (= K45), T43 (≠ S46), T44 (= T47)
Sites not aligning to the query:
Query Sequence
>HSERO_RS07480 FitnessBrowser__HerbieS:HSERO_RS07480
MAHGSSVSLKRVGLTIGSNDIMAGIDLDIRAGEFVCLLGPSGCGKSTLLNAIAGFQDVSG
EISVDGKRVKGPGLDRGVVFQSSEALFPWLSVRENVEYGLKLRGVASAERRAAAERYVSL
VGLKHAIDKFPAELSGGMRQRAQIARVLVNEPSVVLMDEPFGALDAQTREVLQSELDRIW
KSTGCTIVFVTHDIWEAILLADRVVTMTAGPRAHIKTIEEVHLPHPRDPADPACMALYAR
IRDDIGAEVTRVLRAQGLLEEESVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory