Comparing HSERO_RS07535 FitnessBrowser__HerbieS:HSERO_RS07535 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
54% identity, 95% coverage: 6:238/244 of query aligns to 4:236/240 of 4ymuJ
3c4jA Abc protein artp in complex with atp-gamma-s
52% identity, 97% coverage: 3:238/244 of query aligns to 3:238/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
52% identity, 97% coverage: 3:238/244 of query aligns to 3:238/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
52% identity, 97% coverage: 3:238/244 of query aligns to 3:238/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
52% identity, 97% coverage: 3:238/244 of query aligns to 3:238/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
54% identity, 97% coverage: 2:238/244 of query aligns to 1:236/241 of 4u00A
P02915 Histidine/lysine/arginine/ornithine transport ATP-binding protein HisP; EC 7.4.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
50% identity, 97% coverage: 8:244/244 of query aligns to 11:258/258 of P02915
1b0uA Atp-binding subunit of the histidine permease from salmonella typhimurium (see paper)
50% identity, 97% coverage: 8:244/244 of query aligns to 7:254/258 of 1b0uA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 97% coverage: 3:238/244 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
43% identity, 97% coverage: 3:238/244 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
43% identity, 97% coverage: 3:238/244 of query aligns to 2:242/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
43% identity, 97% coverage: 3:238/244 of query aligns to 2:242/344 of 6cvlD
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 98% coverage: 2:239/244 of query aligns to 16:249/378 of P69874
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
36% identity, 93% coverage: 1:228/244 of query aligns to 1:229/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
36% identity, 93% coverage: 3:228/244 of query aligns to 3:229/229 of 6z67B
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
36% identity, 95% coverage: 7:238/244 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
36% identity, 95% coverage: 7:238/244 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
8g4cB Bceabs atpgs high res tm (see paper)
34% identity, 93% coverage: 3:228/244 of query aligns to 3:238/248 of 8g4cB
5ws4A Crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii (see paper)
36% identity, 95% coverage: 3:234/244 of query aligns to 4:245/650 of 5ws4A
7ahdC Opua (e190q) occluded (see paper)
37% identity, 91% coverage: 7:229/244 of query aligns to 30:254/260 of 7ahdC
Sites not aligning to the query:
>HSERO_RS07535 FitnessBrowser__HerbieS:HSERO_RS07535
MPIVEINNITKRFGSNQVLNGISLSVERGQVVAIIGRSGSGKSTMLRCINGLETIDGGSI
TVAGHKLTHKHEHLIELRKDVGMVFQHYNLFPHLTVEENIMLSPRIVKKTATETARETAI
KVLKQVGLDHKRDAYPEQLSGGQQQRVAIARSLAMEPQVMLFDEVTSALDPELTAEVLKV
MEELARGGMTMLLVTHEMEFARRVADLTVFMHQGKVWEARPSEEFFADPQTPEARQFIGA
GAIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory