Comparing HSERO_RS07840 FitnessBrowser__HerbieS:HSERO_RS07840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
4qhqA The structure of a nutrient binding protein from burkholderia cenocepacia bound to methionine
48% identity, 87% coverage: 35:263/263 of query aligns to 10:241/241 of 4qhqA
P04846 Lipoprotein 28 from Escherichia coli (strain K12) (see paper)
45% identity, 84% coverage: 44:263/263 of query aligns to 52:272/272 of P04846
Sites not aligning to the query:
4ib2A Crystal structure of a putative lipoprotein (rumgna_00858) from ruminococcus gnavus atcc 29149 at 1.76 a resolution
41% identity, 90% coverage: 24:261/263 of query aligns to 5:245/247 of 4ib2A
4yahX Crystal structure of the methionine binding protein, metq (see paper)
42% identity, 90% coverage: 28:263/263 of query aligns to 9:243/245 of 4yahX
1xs5A The crystal structure of lipoprotein tp32 from treponema pallidum (see paper)
40% identity, 87% coverage: 35:262/263 of query aligns to 13:240/240 of 1xs5A
3k2dA Crystal structure of immunogenic lipoprotein a from vibrio vulnificus (see paper)
43% identity, 78% coverage: 44:247/263 of query aligns to 26:228/237 of 3k2dA
3tqwA Structure of a abc transporter, periplasmic substrate-binding protein from coxiella burnetii (see paper)
43% identity, 87% coverage: 35:262/263 of query aligns to 10:235/235 of 3tqwA
4oteB Crystal structure of a putative lipoprotein (cd630_1653) from clostridium difficile 630 at 2.20 a resolution
39% identity, 90% coverage: 26:263/263 of query aligns to 5:240/240 of 4oteB
3gxaC Crystal structure of gna1946 (see paper)
39% identity, 85% coverage: 39:262/263 of query aligns to 16:237/244 of 3gxaC
6jf1A Crystal structure of the substrate binding protein of a methionine transporter from streptococcus pneumoniae (see paper)
40% identity, 85% coverage: 40:263/263 of query aligns to 28:260/260 of 6jf1A
Sites not aligning to the query:
6dzxA Crystal structure of the n. Meningitides methionine-binding protein in its d-methionine bound conformation. (see paper)
39% identity, 85% coverage: 39:262/263 of query aligns to 15:236/240 of 6dzxA
4ntlA Crystal structure of a lipoprotein, yaec family (ef3198) from enterococcus faecalis v583 at 1.80 a resolution
33% identity, 91% coverage: 25:263/263 of query aligns to 1:242/242 of 4ntlA
1p99A 1.7a crystal structure of protein pg110 from staphylococcus aureus (see paper)
37% identity, 81% coverage: 40:253/263 of query aligns to 14:231/255 of 1p99A
>HSERO_RS07840 FitnessBrowser__HerbieS:HSERO_RS07840
MIRKLIPHLFAGAALAFSVGAHAADKLVIAATPVPHAEILEHIKPALAKEGIDLQVKVFT
DYVQPAAQTNEKQVDGNFFLHQPYLDQFKKSHKNDIEVPVAKVHVEPFAAYSQKYKKIAD
IPNGATIAIPNDPSNSGRALLLLARNGLIKLKDNTNISATQKDIVENPKKLKFRALEAAT
LPRVLNQVDVALINTNYALEAKLNPVKDSLFIEDANSPYANLLVAREDNKDSPAIKKLAA
ALNSPDVKKFIEEKYQGAIVPAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory