Comparing HSERO_RS07880 FitnessBrowser__HerbieS:HSERO_RS07880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
40% identity, 90% coverage: 3:299/330 of query aligns to 2:298/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
40% identity, 90% coverage: 3:299/330 of query aligns to 1:287/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
35% identity, 95% coverage: 6:319/330 of query aligns to 4:324/330 of P0AAH4
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
35% identity, 78% coverage: 6:262/330 of query aligns to 4:250/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
35% identity, 78% coverage: 6:262/330 of query aligns to 4:250/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
35% identity, 78% coverage: 6:262/330 of query aligns to 4:250/250 of 7z16I
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 74% coverage: 20:262/330 of query aligns to 17:249/375 of 2d62A
1g291 Malk (see paper)
34% identity, 74% coverage: 20:262/330 of query aligns to 14:246/372 of 1g291
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 77% coverage: 6:258/330 of query aligns to 2:243/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 77% coverage: 6:258/330 of query aligns to 3:244/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 77% coverage: 6:258/330 of query aligns to 3:244/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 77% coverage: 6:258/330 of query aligns to 3:244/344 of 6cvlD
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 77% coverage: 24:276/330 of query aligns to 19:253/393 of P9WQI3
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
27% identity, 86% coverage: 12:296/330 of query aligns to 29:297/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
27% identity, 86% coverage: 12:296/330 of query aligns to 29:297/382 of 7aheC
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
31% identity, 74% coverage: 21:263/330 of query aligns to 15:240/363 of 8hprC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
31% identity, 74% coverage: 21:263/330 of query aligns to 15:240/362 of 8hprD
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
31% identity, 73% coverage: 24:263/330 of query aligns to 16:238/384 of 8hplC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 77% coverage: 6:259/330 of query aligns to 4:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 77% coverage: 6:259/330 of query aligns to 4:241/242 of 3c41J
>HSERO_RS07880 FitnessBrowser__HerbieS:HSERO_RS07880
MSALTLEVRNLRTHFFTPEGVLPAVDDVSLSVGRGRILGLVGESGSGKSVTGFSILGMVD
APGRIVGGEILFQGRDLVRMDKTSLRELQGNRIAMIFQDPMMTLNPVLKVEAQMVDAVLA
HSKVSRQQARELARDTLGMMGIASPEERLQAYPHQLSGGMRQRVAIAIAMLHKPDLIIAD
EPTTALDVTIQAQILSEVQKLARQHGTALIWITHDLSVVAGLADEVAVMYAGRIVEQGSV
DAVLDAPLHPYTQGLIGSLPSNNRRGARLRQIPGMTPNLLHLPPTCAFAARCERLSQQCL
VAPAISEPLPAHRVRCYHPTPSTQSSEQHG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory