Comparing HSERO_RS07935 FitnessBrowser__HerbieS:HSERO_RS07935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
3p47A Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-cysteine (see paper)
39% identity, 85% coverage: 33:288/300 of query aligns to 29:268/270 of 3p47A
3q1xA Crystal structure of entamoeba histolytica serine acetyltransferase 1 in complex with l-serine (see paper)
39% identity, 85% coverage: 33:288/300 of query aligns to 27:266/267 of 3q1xA
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
38% identity, 83% coverage: 33:282/300 of query aligns to 27:252/280 of 7bw9A
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
35% identity, 85% coverage: 30:283/300 of query aligns to 10:230/243 of 4n69A
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
38% identity, 55% coverage: 118:283/300 of query aligns to 71:227/257 of 1ssqD
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
37% identity, 55% coverage: 120:283/300 of query aligns to 78:232/261 of 6wyeA
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
37% identity, 55% coverage: 120:283/300 of query aligns to 76:230/243 of 7ra4A
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
38% identity, 57% coverage: 118:289/300 of query aligns to 75:237/250 of 4hzdA
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
34% identity, 85% coverage: 30:283/300 of query aligns to 6:220/233 of 4n6bA
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
36% identity, 61% coverage: 102:284/300 of query aligns to 66:235/272 of 3gvdI
1sstA Serine acetyltransferase- complex with coa (see paper)
37% identity, 55% coverage: 118:283/300 of query aligns to 71:220/233 of 1sstA
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
38% identity, 53% coverage: 126:283/300 of query aligns to 83:231/262 of 1t3dA
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
35% identity, 57% coverage: 118:289/300 of query aligns to 71:233/258 of 4h7oA
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
37% identity, 53% coverage: 126:283/300 of query aligns to 79:227/258 of 8i04A
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
37% identity, 53% coverage: 126:283/300 of query aligns to 82:230/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
37% identity, 53% coverage: 126:283/300 of query aligns to 83:231/244 of 8i06A
Sites not aligning to the query:
>HSERO_RS07935 FitnessBrowser__HerbieS:HSERO_RS07935
LVDTAGLGLSAVVAGLRTSREVTNKIRYRGEIRELPSREAMHKLLQHLQAALFPTHYGHT
DLSDETIDYFVGSQLNTGLSILKEQVRRSLYFSSDLQEDAPLREQAARITRDFAHQLPAV
RDVLVSDIQAAYHGDPAASSISEILLCYPGTTAIIYHRLAHALHQLGAPLLARLIADIAH
SATGIDIHPAAQIGPSFFIDHGTGVVIGETTIIGRNVRLYQAVTLGAKRFPQEPDGSLVK
GIPRHPIVEDDVVVYAGATLLGRITIGRGSVIGGNVWLTHSVPAGSNVSQAEMLSDCRQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory