Comparing HSERO_RS08035 FitnessBrowser__HerbieS:HSERO_RS08035 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
8gxfB Pseudomonas flexibilis gcn5 family acetyltransferase (see paper)
30% identity, 96% coverage: 6:193/195 of query aligns to 5:186/187 of 8gxfB
8gxkB Pseudomonas jinjuensis n-acetyltransferase (see paper)
33% identity, 95% coverage: 6:190/195 of query aligns to 5:183/188 of 8gxkB
1yreB Hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
32% identity, 95% coverage: 6:190/195 of query aligns to 5:183/187 of 1yreB
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
29% identity, 83% coverage: 34:195/195 of query aligns to 51:205/209 of 6c37A
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
29% identity, 83% coverage: 34:195/195 of query aligns to 51:205/209 of 6c32A
>HSERO_RS08035 FitnessBrowser__HerbieS:HSERO_RS08035
MQFLSPITLKGQFATIEPLHPEHHDALIAAVSDGKLWKLWYTAVPKPENMRAEIERRLHL
QQQGSMLPFVIRRNDTGALCGMTTYMNADSVHRRVEIGSTWYAASAQRTGINTECKLMML
THAFEDMHCIAVEFRTHWMNQQSRAAIARLGAKQDGVLRNHMRMPDGSYRDTVVFSIIES
EWPTVRRHLQFKLGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory