Comparing HSERO_RS08065 FitnessBrowser__HerbieS:HSERO_RS08065 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
30% identity, 86% coverage: 40:378/394 of query aligns to 3:336/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
30% identity, 86% coverage: 40:378/394 of query aligns to 3:336/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
30% identity, 86% coverage: 40:378/394 of query aligns to 3:336/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
30% identity, 86% coverage: 40:378/394 of query aligns to 3:336/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
30% identity, 86% coverage: 40:378/394 of query aligns to 3:336/348 of 3ipcA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
27% identity, 86% coverage: 40:376/394 of query aligns to 3:333/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
27% identity, 86% coverage: 40:376/394 of query aligns to 3:333/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
27% identity, 86% coverage: 40:376/394 of query aligns to 3:333/344 of 1z16A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
26% identity, 87% coverage: 38:381/394 of query aligns to 1:341/345 of 4n0qB
1uskA L-leucine-binding protein with leucine bound (see paper)
26% identity, 86% coverage: 40:376/394 of query aligns to 3:335/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
26% identity, 86% coverage: 40:376/394 of query aligns to 3:335/345 of 1usiA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
27% identity, 82% coverage: 62:383/394 of query aligns to 21:334/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
24% identity, 85% coverage: 51:383/394 of query aligns to 10:333/335 of 4q6bA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
26% identity, 85% coverage: 39:374/394 of query aligns to 2:333/348 of 4gnrA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
27% identity, 82% coverage: 47:369/394 of query aligns to 9:327/350 of 3td9A
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
25% identity, 83% coverage: 39:364/394 of query aligns to 3:348/376 of 4q6wA
4rv5A The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with pyruvic acid
21% identity, 90% coverage: 39:391/394 of query aligns to 2:363/364 of 4rv5A
4obbA The crystal structure of a solute-binding protein from anabaena variabilis atcc 29413 in complex with (3s)-3-methyl-2-oxopentanoic acid.
21% identity, 90% coverage: 39:391/394 of query aligns to 2:363/364 of 4obbA
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
21% identity, 90% coverage: 39:391/394 of query aligns to 2:363/364 of 4rdcA
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
21% identity, 90% coverage: 39:391/394 of query aligns to 2:363/364 of 4qymA
>HSERO_RS08065 FitnessBrowser__HerbieS:HSERO_RS08065
MQCVARLLAALLALATLGAPVGATAQPRAPLPDRQETATLAIGFAGPLSGPSGGVGKSMQ
NGVQLALAEANRRGLRIGGKSWQLRLIAQDDRADPATAEFVARSLVQQQVIAVVGHWTSG
TSLAAAPVYHRAGVIQVTPSAMSRRLTAMSYPRIFRTIPNNESLGRLAAGYAVDKLETRT
IVTIDDRTPFGQGLAEQFARTASERGAQVVGRYSVSDKTSDFNAALLEARKLQPDLIFFG
GLDWQAGVLAKSIRRLKLHARLMASPGTLGLPFLMRAGPDANGALVLEPGPPQDKMPGWK
SFRQRYSENFDSDMDLYAVFAYEAAQAIIQGIRQAGSADPERIAEAMHRLRFEGVSGPVA
FNEEGDLLQPSFTMYEVKDQRWQPVARFNGLPRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory