Comparing HSERO_RS08335 FitnessBrowser__HerbieS:HSERO_RS08335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
59% identity, 96% coverage: 17:364/364 of query aligns to 1:351/352 of 1cjxA
7xntA Crystal structure of pfhppd-y13161 complex
59% identity, 95% coverage: 15:358/364 of query aligns to 2:341/341 of 7xntA
7x8eA Crystal structure of pfhppd-y13287 complex
58% identity, 96% coverage: 15:362/364 of query aligns to 1:341/341 of 7x8eA
7xntC Crystal structure of pfhppd-y13161 complex
56% identity, 93% coverage: 15:353/364 of query aligns to 1:320/320 of 7xntC
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
37% identity, 94% coverage: 5:346/364 of query aligns to 273:614/635 of Q88JU3
Sites not aligning to the query:
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
37% identity, 94% coverage: 5:346/364 of query aligns to 275:611/624 of 5hmqD
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
40% identity, 76% coverage: 86:360/364 of query aligns to 81:362/362 of 1t47A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
33% identity, 82% coverage: 63:362/364 of query aligns to 63:379/393 of P32755
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
33% identity, 82% coverage: 63:362/364 of query aligns to 55:371/376 of 5ec3A
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
33% identity, 82% coverage: 63:362/364 of query aligns to 57:373/374 of 8im2A
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
33% identity, 93% coverage: 21:358/364 of query aligns to 11:346/357 of O52791
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
32% identity, 81% coverage: 63:358/364 of query aligns to 57:369/371 of 8im3A
2r5vA Hydroxymandelate synthase crystal structure (see paper)
33% identity, 93% coverage: 21:358/364 of query aligns to 10:344/346 of 2r5vA
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
34% identity, 76% coverage: 86:362/364 of query aligns to 89:379/393 of Q02110
Sites not aligning to the query:
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
32% identity, 79% coverage: 63:349/364 of query aligns to 56:343/343 of 1sqiA
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
32% identity, 79% coverage: 63:349/364 of query aligns to 57:342/342 of 1sqiB
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
28% identity, 89% coverage: 31:355/364 of query aligns to 12:339/343 of 3zgjB
7yvvA Acmp1, r-4-hydroxymandelate synthase
28% identity, 79% coverage: 70:355/364 of query aligns to 57:331/335 of 7yvvA
1sp9B 4-hydroxyphenylpyruvate dioxygenase (see paper)
28% identity, 91% coverage: 26:355/364 of query aligns to 15:369/374 of 1sp9B
P93836 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 91% coverage: 26:355/364 of query aligns to 47:432/445 of P93836
>HSERO_RS08335 FitnessBrowser__HerbieS:HSERO_RS08335
MGHTETNFAPAASGDLFDNPMGTDGFEFVEYTAADPAAIARVLELMGFTAVARHRSKNVT
LYRQGQVNFILNGEPGSNAAAFAQVHGASVNAMAFRVKDAAQVYKRALELGAEGVEAKLG
PMELNIPAIRGIGGSLLYLVDRYGENGSIYDVDFQFFPGVERNPKGVGLTYIDHLTHNVM
RGAMDTWSSFYTRLFNFREIKYFDIEGKVTGLRSRAMTSPCGKIRIPINESADDKSQIEE
FIKQYNGEGIQHIALGTDDIYQTVRALRERGVPLQDTISTYYDLVERRIPGHGEDLDALR
ELKILIDGAPTAGQGLLLQIFTQNLIGPVFYEIIQRKGNDGFGEGNFKALFESIELDQMR
RGVI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory