Comparing HSERO_RS08545 FitnessBrowser__HerbieS:HSERO_RS08545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
40% identity, 61% coverage: 13:241/377 of query aligns to 34:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
40% identity, 61% coverage: 13:241/377 of query aligns to 34:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
39% identity, 60% coverage: 13:238/377 of query aligns to 34:260/260 of 7ahdC
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 64% coverage: 1:242/377 of query aligns to 1:244/375 of 2d62A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 92% coverage: 4:349/377 of query aligns to 17:375/378 of P69874
1g291 Malk (see paper)
39% identity, 60% coverage: 18:242/377 of query aligns to 15:241/372 of 1g291
Sites not aligning to the query:
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 64% coverage: 2:242/377 of query aligns to 4:236/393 of P9WQI3
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
35% identity, 64% coverage: 1:241/377 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
8hplC Lpqy-sugabc in state 1 (see paper)
36% identity, 64% coverage: 2:242/377 of query aligns to 3:233/384 of 8hplC
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
37% identity, 64% coverage: 2:242/377 of query aligns to 7:230/353 of 1vciA
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
35% identity, 64% coverage: 1:241/377 of query aligns to 2:242/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
35% identity, 64% coverage: 1:241/377 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
35% identity, 64% coverage: 1:241/377 of query aligns to 2:242/344 of 3tuiC
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
36% identity, 58% coverage: 25:242/377 of query aligns to 21:234/374 of 2awnB
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
36% identity, 64% coverage: 2:242/377 of query aligns to 3:235/363 of 8hprC
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
36% identity, 58% coverage: 25:242/377 of query aligns to 21:234/371 of 3puyA
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
36% identity, 58% coverage: 25:242/377 of query aligns to 21:234/371 of 3puxA
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
36% identity, 58% coverage: 25:242/377 of query aligns to 21:234/371 of 3puwA
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
36% identity, 58% coverage: 25:242/377 of query aligns to 21:234/371 of 3puvA
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
36% identity, 64% coverage: 2:242/377 of query aligns to 3:235/362 of 8hprD
>HSERO_RS08545 FitnessBrowser__HerbieS:HSERO_RS08545
MIALDQLSKTYTQKDGTQVKAVDAVSLKVAEGEICVFLGPSGCGKTTTLKMINRLINPTS
GRVLLNGQDTSGIDEVELRRHIGYVIQQIGLFPNMTIEENITIVPRLLGWDKKRCQERAT
ELMAMVALDPKKFLKRYPRELSGGQQQRIGVIRALAADAPVLLMDEPFGAVDPINRESIQ
NEFFQMQRQLNKTVIMVSHDIDEAIKLGDKVAVFRAGKLVQFDNPDTLLARPKDDFVSAF
VGQDHTLKRLLLVRAGEAATTPPTAHPDVSCDQALALMDDQDSRYLTIIDADNRALGYLT
RRDVRGSTGVAEDKVRPFTMNADPDENLRVVLSKMYKHSTSWMPVIANDGSYVGEVTQDS
IASYLSSGKSRGMAMAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory