SitesBLAST
Comparing HSERO_RS08715 FitnessBrowser__HerbieS:HSERO_RS08715 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
30% identity, 97% coverage: 5:303/308 of query aligns to 3:305/308 of 2dcnA
- active site: G252 (= G250), A253 (= A251), G254 (= G252), D255 (= D253)
- binding adenosine-5'-diphosphate: D193 (≠ S190), K223 (= K221), G225 (= G223), P226 (≠ K224), G228 (= G226), V247 (≠ S245), G254 (= G252), I279 (≠ N277), S282 (≠ A280), V286 (≠ T284)
- binding 6-O-phosphono-beta-D-psicofuranosonic acid: G33 (= G31), F89 (≠ Y87), Y105 (≠ H99), R107 (= R101), I136 (= I131), R165 (= R164), T251 (= T249), G252 (= G250), D255 (= D253), D291 (≠ A289)
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
28% identity, 97% coverage: 5:303/308 of query aligns to 4:308/313 of Q97U29
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
28% identity, 97% coverage: 5:303/308 of query aligns to 3:307/311 of 2varA
- active site: G254 (= G250), A255 (= A251), G256 (= G252), D257 (= D253)
- binding adenosine monophosphate: G227 (= G223), G230 (= G226), M259 (≠ F255), S284 (≠ A280), I288 (≠ T284)
- binding phosphoaminophosphonic acid-adenylate ester: K225 (= K221), G227 (= G223), S228 (≠ K224), G230 (= G226), G254 (= G250), A255 (= A251), G256 (= G252), D257 (= D253), M259 (≠ F255), I281 (≠ N277), S284 (≠ A280), I288 (≠ T284)
- binding 3-deoxy-alpha-D-erythro-hex-2-ulofuranosonic acid: L10 (≠ M12), G33 (= G31), S34 (≠ D32), Y89 (= Y87), Y105 (= Y100), R107 (= R102), I136 (= I131), R165 (= R164), G254 (= G250), D257 (= D253)
- binding 2-keto-3-deoxygluconate: G33 (= G31), S34 (≠ D32), Y89 (= Y87), L103 (≠ F98), Y105 (= Y100), R107 (= R102), I136 (= I131), R165 (= R164), T253 (= T249), G254 (= G250), D257 (= D253), D293 (≠ A289)
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
30% identity, 98% coverage: 5:305/308 of query aligns to 4:307/308 of 3iq0B
- active site: G252 (= G250), A253 (= A251), G254 (= G252), D255 (= D253)
- binding adenosine-5'-triphosphate: S192 (= S190), K223 (= K221), G225 (= G223), E247 (≠ S245), A253 (= A251), G254 (= G252), F257 (= F255), N279 (= N277), G282 (≠ A280)
5yggA Crystal structure of fructokinase double-mutant (t261c-h108c) from vibrio cholerae o395 in fructose, adp and potassium ion bound form (see paper)
30% identity, 98% coverage: 1:303/308 of query aligns to 5:309/310 of 5yggA
- binding adenosine-5'-diphosphate: K188 (≠ L188), T221 (≠ K221), G223 (= G223), A242 (≠ P242), V243 (= V243), F255 (= F255), N283 (= N277), G286 (≠ A280), A287 (= A281)
- binding beta-D-fructofuranose: D13 (≠ E10), D17 (≠ E14), G32 (= G31), A33 (≠ D32), F100 (= F98), F102 (≠ Y100), R163 (= R164), D253 (= D253)
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
30% identity, 98% coverage: 1:303/308 of query aligns to 1:305/306 of 5eynA
- active site: G246 (= G250), A247 (= A251), G248 (= G252), D249 (= D253)
- binding adenosine-5'-diphosphate: H91 (≠ A94), T217 (≠ K221), G219 (= G223), A220 (≠ K224), A238 (≠ P242), V239 (= V243), T244 (≠ A248), G246 (= G250), A247 (= A251), G248 (= G252), F251 (= F255), N279 (= N277), G282 (≠ A280), A283 (= A281)
- binding beryllium trifluoride ion: G246 (= G250), G248 (= G252), D249 (= D253)
- binding beta-D-fructofuranose: D9 (≠ E10), D13 (≠ E14), G28 (= G31), A29 (≠ D32), N32 (= N35), F96 (= F98), F98 (≠ Y100), R159 (= R164), D249 (= D253)
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
32% identity, 93% coverage: 23:307/308 of query aligns to 25:305/309 of Q53W83
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
32% identity, 91% coverage: 23:303/308 of query aligns to 25:301/301 of 1v1aA
- active site: G248 (= G250), A249 (= A251), G250 (= G252), D251 (= D253)
- binding adenosine-5'-diphosphate: K219 (= K221), G221 (= G223), A222 (≠ K224), A249 (= A251), G250 (= G252), N275 (= N277), A279 (= A281)
- binding 2-keto-3-deoxygluconate: G34 (= G31), A35 (≠ D32), N38 (= N35), Y89 (= Y87), R105 (= R101), R167 (= R164), G248 (= G250), D251 (= D253), D287 (≠ A289)
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
32% identity, 91% coverage: 23:302/308 of query aligns to 25:300/300 of 1v1bA
- active site: G248 (= G250), A249 (= A251), G250 (= G252), D251 (= D253)
- binding adenosine-5'-triphosphate: K219 (= K221), G221 (= G223), A238 (≠ P240), F239 (≠ Y241), V241 (= V243), G248 (= G250), A249 (= A251), G250 (= G252), N275 (= N277), A279 (= A281)
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
30% identity, 89% coverage: 30:303/308 of query aligns to 39:308/312 of 3in1A
- active site: R106 (≠ H96), G255 (= G250), A256 (= A251), G257 (= G252), D258 (= D253)
- binding adenosine-5'-diphosphate: N194 (≠ S190), K225 (= K221), G227 (= G223), G230 (= G226), A244 (= A239), T253 (≠ A248), N282 (= N277), A285 (= A280)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
34% identity, 85% coverage: 5:267/308 of query aligns to 17:280/306 of 4ebuA
Sites not aligning to the query:
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
34% identity, 85% coverage: 5:267/308 of query aligns to 17:276/294 of 4eumA
Sites not aligning to the query:
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
30% identity, 90% coverage: 30:307/308 of query aligns to 38:306/306 of 4xckA
- active site: A249 (≠ G250), A250 (= A251), G251 (= G252), D252 (= D253)
- binding adenosine-5'-diphosphate: T220 (≠ K221), G222 (= G223), S223 (≠ K224), V242 (= V243), T247 (≠ A248), A250 (= A251), F254 (= F255), H276 (≠ N277), A279 (= A280), V283 (≠ T284)
- binding alpha-D-ribofuranose: G39 (= G31), K40 (≠ D32), N43 (= N35), A95 (≠ Y87), I107 (≠ H99), I109 (≠ R101), E140 (= E137), T248 (= T249), D252 (= D253)
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
30% identity, 90% coverage: 23:299/308 of query aligns to 25:293/304 of 3ih0A
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
30% identity, 90% coverage: 23:299/308 of query aligns to 24:292/302 of 3gbuA
- active site: G242 (= G250), A243 (= A251), G244 (= G252), D245 (= D253)
- binding adenosine-5'-triphosphate: K188 (≠ L188), T213 (≠ K221), G215 (= G223), V235 (= V243), P237 (≠ S245), A243 (= A251), G244 (= G252), A274 (= A280)
1gqtB Activation of ribokinase by monovalent cations (see paper)
29% identity, 89% coverage: 29:303/308 of query aligns to 39:304/307 of 1gqtB
- active site: A251 (≠ G250), A252 (= A251), G253 (= G252), D254 (= D253)
- binding phosphomethylphosphonic acid adenylate ester: N186 (≠ S190), T222 (≠ K221), G224 (= G223), S225 (≠ K224), A252 (= A251), G253 (= G252), H278 (≠ N277), A281 (= A280)
- binding cesium ion: D248 (= D247), I250 (≠ T249), A284 (≠ S283), R287 (≠ G286), S293 (≠ P292)
- binding alpha-D-ribofuranose: G41 (= G31), N45 (= N35), E142 (= E137), D254 (= D253)
Sites not aligning to the query:
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 89% coverage: 29:303/308 of query aligns to 40:305/309 of P0A9J6
Sites not aligning to the query:
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
28% identity, 89% coverage: 29:303/308 of query aligns to 37:302/305 of 1rk2A
- active site: A249 (≠ G250), A250 (= A251), G251 (= G252), D252 (= D253)
- binding adenosine-5'-diphosphate: T220 (≠ K221), G222 (= G223), S223 (≠ K224), A250 (= A251), G251 (= G252), H276 (≠ N277), A279 (= A280)
- binding tetrafluoroaluminate ion: G213 (= G214), R215 (≠ K216)
- binding magnesium ion: D246 (= D247), A282 (≠ S283), R285 (≠ G286), S291 (≠ P292)
- binding alpha-D-ribofuranose: G38 (= G30), G39 (= G31), K40 (≠ D32), N43 (= N35), E140 (= E137), D252 (= D253)
Sites not aligning to the query:
8cqxA Ribokinase from t.Sp mutant a92g
31% identity, 89% coverage: 30:303/308 of query aligns to 36:298/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (≠ R176), T217 (≠ K221), G219 (= G223), A220 (≠ K224), G222 (= G226), F250 (= F255), N272 (= N277), G275 (≠ A280), A276 (= A281), T279 (= T284)
- binding magnesium ion: D242 (= D247), T244 (= T249), A278 (≠ S283), S287 (≠ P292)
6a8cA Ribokinase from leishmania donovani with adp (see paper)
25% identity, 96% coverage: 5:301/308 of query aligns to 16:324/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G223), A246 (≠ K224), T271 (≠ A248), A274 (= A251), G275 (= G252), N300 (= N277), A303 (= A280)
- binding glycerol: D25 (≠ E14), S42 (vs. gap), S44 (vs. gap), G50 (= G30), G51 (= G31), N55 (= N35)
Query Sequence
>HSERO_RS08715 FitnessBrowser__HerbieS:HSERO_RS08715
MSKTILAYGEAMVEFNQRIDAPRQFLQGYGGDTSNFAIAAARQGAASAYLSAVGDDHFGQ
DLLALWQREEVDVRHVAIAPGGSTGIYFVTHDAAGHHFHYRRAGSAASAYQAKALPLEAI
AAAGALHLSGISLAISESACEAGLAAMAHARASGVTTSLDTNLRLRLWPLERARARMEEA
FRLCDICLPSWEDVSLLTGLEDRDAIVDRLLSYGVKLVAFKLGKEGCYVATSDQRRMVAP
YPVDSLDATGAGDCFGGAFMAELMAGRDAFAAARYANVAAALSTTGYGAVEPIPRRAQVE
AVLAKTSG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory