Comparing HSERO_RS08805 FitnessBrowser__HerbieS:HSERO_RS08805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
49% identity, 100% coverage: 1:237/238 of query aligns to 12:249/250 of 4y96A
Sites not aligning to the query:
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
50% identity, 87% coverage: 22:228/238 of query aligns to 434:641/654 of P36204
Sites not aligning to the query:
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
45% identity, 98% coverage: 1:234/238 of query aligns to 12:247/253 of P27876
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
47% identity, 99% coverage: 1:236/238 of query aligns to 11:248/251 of 1btmA
Sites not aligning to the query:
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
47% identity, 99% coverage: 1:236/238 of query aligns to 12:249/253 of P00943
Sites not aligning to the query:
4mvaA 1.43 angstrom resolution crystal structure of triosephosphate isomerase (tpia) from escherichia coli in complex with acetyl phosphate. (see paper)
47% identity, 100% coverage: 1:237/238 of query aligns to 12:249/255 of 4mvaA
B1XB85 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Escherichia coli (strain K12 / DH10B) (see paper)
47% identity, 100% coverage: 1:237/238 of query aligns to 12:249/255 of B1XB85
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
47% identity, 99% coverage: 1:236/238 of query aligns to 14:250/252 of 6neeB
Sites not aligning to the query:
P50921 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Moritella marina (Vibrio marinus) (see paper)
47% identity, 94% coverage: 2:225/238 of query aligns to 9:239/256 of P50921
1aw1A Triosephosphate isomerase of vibrio marinus complexed with 2- phosphoglycolate (see paper)
47% identity, 94% coverage: 2:225/238 of query aligns to 8:238/255 of 1aw1A
5eywA Crystal structure of litopenaeus vannamei triosephosphate isomerase complexed with 2-phosphoglycolic acid (see paper)
47% identity, 99% coverage: 1:236/238 of query aligns to 11:243/244 of 5eywA
Sites not aligning to the query:
1ci1B Crystal structure of triosephosphate isomerase from trypanosoma cruzi in hexane (see paper)
47% identity, 99% coverage: 2:236/238 of query aligns to 10:247/249 of 1ci1B
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
46% identity, 100% coverage: 1:238/238 of query aligns to 15:248/248 of A0A1L5YRA2
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
48% identity, 99% coverage: 2:236/238 of query aligns to 14:247/249 of 2y63A
Sites not aligning to the query:
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
48% identity, 99% coverage: 2:236/238 of query aligns to 14:247/249 of 2y61A
Sites not aligning to the query:
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
48% identity, 99% coverage: 2:236/238 of query aligns to 14:247/249 of 2vxnA
Sites not aligning to the query:
1if2A X-ray structure of leishmania mexicana triosephosphate isomerase complexed with ipp (see paper)
48% identity, 99% coverage: 2:236/238 of query aligns to 14:247/249 of 1if2A
Sites not aligning to the query:
1amkA Leishmania mexicana triose phosphate isomerase (see paper)
47% identity, 99% coverage: 2:236/238 of query aligns to 15:248/250 of 1amkA
Sites not aligning to the query:
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
44% identity, 99% coverage: 1:236/238 of query aligns to 13:246/248 of P00942
Sites not aligning to the query:
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
44% identity, 99% coverage: 1:236/238 of query aligns to 15:250/252 of 6oogA
Sites not aligning to the query:
>HSERO_RS08805 FitnessBrowser__HerbieS:HSERO_RS08805
MNGSLAANAALVAGIKEGLAAQACDVAVCVPAPYLAQVQALVAGSPVGLGAQDMSAHASG
AYTGEVSASMLQEFGVQYVILGHSERRAYHGESDAAVAAKTVAALKAGLVPLVCVGETLE
QREAGQTNAVVGGQLDVVLAALSAEEAARIVVAYEPVWAIGTGKTATPEMAQEVHAMLRA
RLGAKSAEAAAKVCILYGGSMKPDNAQQLLAMGDIDGGLIGGAALKAADFLAIINAAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory