SitesBLAST
Comparing HSERO_RS09030 FitnessBrowser__HerbieS:HSERO_RS09030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 4.3.1.17; EC 4.3.1.18; EC 5.1.1.18 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
28% identity, 91% coverage: 8:325/351 of query aligns to 6:323/323 of O59791
- S82 (≠ R85) mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
28% identity, 91% coverage: 8:325/351 of query aligns to 2:319/319 of 2zr8A
- active site: K53 (= K59), S78 (≠ R85), E204 (≠ V210), G208 (≠ A214), D210 (≠ A216), G232 (= G238), I303 (≠ L309), S304 (= S310)
- binding magnesium ion: E204 (≠ V210), G208 (≠ A214), D210 (≠ A216)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F58), K53 (= K59), S77 (≠ T84), S78 (≠ R85), N80 (= N87), H81 (= H88), P147 (≠ S154), G179 (= G185), G180 (≠ Q186), G181 (= G187), G182 (≠ S188), G232 (= G238), E277 (= E283), T279 (≠ A285), S304 (= S310)
- binding serine: S78 (≠ R85), R129 (≠ S136), D231 (= D237), G232 (= G238), A233 (≠ V239), Q234 (≠ A240), T235 (≠ C241)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
28% identity, 91% coverage: 8:325/351 of query aligns to 2:319/319 of 2zpuA
- active site: K53 (= K59), S78 (≠ R85), E204 (≠ V210), G208 (≠ A214), D210 (≠ A216), G232 (= G238), I303 (≠ L309), S304 (= S310)
- binding magnesium ion: E204 (≠ V210), G208 (≠ A214), D210 (≠ A216)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F58), K53 (= K59), S77 (≠ T84), S78 (≠ R85), N80 (= N87), H81 (= H88), P147 (≠ S154), G179 (= G185), G180 (≠ Q186), G181 (= G187), G182 (≠ S188), G232 (= G238), E277 (= E283), T279 (≠ A285), S304 (= S310)
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
28% identity, 91% coverage: 8:325/351 of query aligns to 1:318/318 of 1wtcA
- active site: K52 (= K59), S77 (≠ R85), E203 (≠ V210), G207 (≠ A214), D209 (≠ A216), G231 (= G238), I302 (≠ L309), S303 (= S310)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ A27), K47 (≠ P54), M48 (≠ T55), A109 (= A117), A110 (= A118), Y114 (≠ L122)
- binding magnesium ion: E203 (≠ V210), G207 (≠ A214), D209 (≠ A216)
- binding pyridoxal-5'-phosphate: F51 (= F58), K52 (= K59), N79 (= N87), G178 (= G185), G179 (≠ Q186), G180 (= G187), G181 (≠ S188), G231 (= G238), E276 (= E283), T278 (≠ A285), S303 (= S310)
1v71A Crystal structure of s.Pombe serine racemase
28% identity, 91% coverage: 8:325/351 of query aligns to 1:318/318 of 1v71A
- active site: K52 (= K59), S77 (≠ R85), E203 (≠ V210), G207 (≠ A214), D209 (≠ A216), G231 (= G238), I302 (≠ L309), S303 (= S310)
- binding magnesium ion: E203 (≠ V210), G207 (≠ A214), D209 (≠ A216)
- binding pyridoxal-5'-phosphate: F51 (= F58), K52 (= K59), N79 (= N87), G178 (= G185), G179 (≠ Q186), G180 (= G187), G181 (≠ S188), G231 (= G238), E276 (= E283), T278 (≠ A285), S303 (= S310), G304 (= G311)
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
30% identity, 90% coverage: 9:323/351 of query aligns to 3:317/319 of A4F2N8
- K53 (= K59) mutation to A: Loss of enzymatic activity.
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
31% identity, 82% coverage: 37:325/351 of query aligns to 36:326/494 of 1tdjA
- active site: K58 (= K59), A83 (≠ R85), E209 (≠ V210), S213 (≠ A214), C215 (≠ A216), G237 (= G238), L310 (= L309), S311 (= S310)
- binding pyridoxal-5'-phosphate: F57 (= F58), K58 (= K59), N85 (= N87), G184 (= G185), G185 (≠ Q186), G186 (= G187), G187 (≠ S188), G237 (= G238), E282 (= E283), S311 (= S310), G312 (= G311)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
31% identity, 82% coverage: 37:325/351 of query aligns to 40:330/514 of P04968
- K62 (= K59) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N87) binding
- GGGGL 188:192 (≠ GQGSG 185:189) binding
- S315 (= S310) binding
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
29% identity, 82% coverage: 37:325/351 of query aligns to 46:338/339 of Q7XSN8
- E219 (≠ V210) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ A216) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
28% identity, 87% coverage: 16:322/351 of query aligns to 17:318/326 of 2gn2A
- active site: K56 (= K59), A81 (≠ R85), Q207 (≠ V210), V211 (≠ A214), G213 (≠ A216), G235 (= G238), I308 (≠ L309), S309 (= S310)
- binding cytidine-5'-monophosphate: R51 (≠ P54), T52 (= T55), G53 (= G56), A114 (= A118), D117 (≠ A121), Y118 (≠ L122), N312 (= N313)
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
29% identity, 87% coverage: 11:315/351 of query aligns to 5:310/310 of 7nbgDDD
- active site: K53 (= K59), S76 (≠ R85), E202 (≠ V210), A206 (= A214), D208 (≠ A216), G231 (= G238), L304 (= L309), S305 (= S310)
- binding calcium ion: E202 (≠ V210), A206 (= A214), D208 (≠ A216)
- binding magnesium ion: N239 (≠ A247)
- binding ortho-xylene: S76 (≠ R85), Q81 (= Q90), I96 (= I105), Y113 (≠ L122)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N78 (= N87), G177 (= G185), G178 (≠ Q186), G179 (= G187), G180 (≠ S188), M181 (≠ G189), G231 (= G238), V232 (= V239), E275 (= E283), T277 (vs. gap), S305 (= S310), G306 (= G311)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
29% identity, 87% coverage: 11:315/351 of query aligns to 6:311/322 of 3l6bA
- active site: K54 (= K59), S77 (≠ R85), E203 (≠ V210), A207 (= A214), D209 (≠ A216), G232 (= G238), T278 (vs. gap), L305 (= L309), S306 (= S310)
- binding malonate ion: K54 (= K59), S76 (≠ T84), S77 (≠ R85), N79 (= N87), H80 (= H88), R128 (= R137), G232 (= G238)
- binding manganese (ii) ion: E203 (≠ V210), A207 (= A214), D209 (≠ A216)
- binding pyridoxal-5'-phosphate: F53 (= F58), K54 (= K59), N79 (= N87), G178 (= G185), G179 (≠ Q186), G180 (= G187), G181 (≠ S188), M182 (≠ G189), V233 (= V239), E276 (= E283), T278 (vs. gap), S306 (= S310), G307 (= G311)
1ve5A Crystal structure of t.Th. Hb8 threonine deaminase
34% identity, 74% coverage: 55:315/351 of query aligns to 46:305/308 of 1ve5A
- active site: K50 (= K59), S56 (≠ V65), S72 (≠ R85), E200 (≠ V210), A204 (= A214), D206 (≠ A216), G229 (= G238), L299 (= L309), S300 (= S310)
- binding calcium ion: E200 (≠ V210), A204 (= A214), D206 (≠ A216)
- binding pyridoxal-5'-phosphate: F49 (= F58), K50 (= K59), N74 (= N87), G175 (= G185), G176 (≠ Q186), G177 (= G187), G178 (≠ S188), E274 (= E283), T276 (≠ A285), S300 (= S310), G301 (= G311)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/322 of 7nbgAAA
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N83 (= N87), G182 (= G185), G183 (≠ Q186), G184 (= G187), G185 (≠ S188), M186 (≠ G189), G236 (= G238), V237 (= V239), T282 (vs. gap), S310 (= S310), G311 (= G311)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ R85), G85 (= G89), Q86 (= Q90), I101 (= I105), K111 (= K115), I115 (≠ M119), Y118 (≠ L122)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/320 of 7nbhAAA
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ R85), G85 (= G89), Q86 (= Q90), K111 (= K115), I115 (≠ M119), Y118 (≠ L122), D235 (= D237), P281 (vs. gap), N313 (= N313), V314 (= V314), D315 (= D315)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/323 of 7nbfAAA
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding magnesium ion: N244 (≠ A247)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N83 (= N87), G182 (= G185), G183 (≠ Q186), G184 (= G187), G185 (≠ S188), M186 (≠ G189), G236 (= G238), V237 (= V239), T282 (vs. gap), S310 (= S310), G311 (= G311)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ A27), L22 (≠ P28), T23 (= T29), P24 (≠ A30), L26 (= L32), T27 (≠ C33), F46 (≠ H52)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/323 of 7nbdAAA
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ Y275), L278 (≠ V281), V314 (= V314)
- binding magnesium ion: N244 (≠ A247)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N83 (= N87), G182 (= G185), G183 (≠ Q186), G184 (= G187), G185 (≠ S188), M186 (≠ G189), G236 (= G238), V237 (= V239), E280 (= E283), T282 (vs. gap), S310 (= S310), G311 (= G311)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/323 of 7nbcCCC
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding biphenyl-4-ylacetic acid: T78 (≠ S82), H79 (≠ A83), H84 (= H88), V148 (≠ I152), H149 (vs. gap), P150 (= P153)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N83 (= N87), G182 (= G185), G183 (≠ Q186), G184 (= G187), G185 (≠ S188), M186 (≠ G189), G236 (= G238), V237 (= V239), T282 (vs. gap), S310 (= S310), G311 (= G311)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
28% identity, 87% coverage: 11:315/351 of query aligns to 5:315/323 of 7nbcAAA
- active site: K53 (= K59), S81 (≠ R85), E207 (≠ V210), A211 (= A214), D213 (≠ A216), G236 (= G238), L309 (= L309), S310 (= S310)
- binding calcium ion: E207 (≠ V210), A211 (= A214), D213 (≠ A216)
- binding magnesium ion: N244 (≠ A247)
- binding pyridoxal-5'-phosphate: F52 (= F58), K53 (= K59), N83 (= N87), G182 (= G185), G183 (≠ Q186), G184 (= G187), G185 (≠ S188), M186 (≠ G189), G236 (= G238), V237 (= V239), T282 (vs. gap), S310 (= S310), G311 (= G311)
Sites not aligning to the query:
6zspAAA serine racemase bound to atp and malonate. (see paper)
29% identity, 87% coverage: 11:315/351 of query aligns to 5:308/320 of 6zspAAA
- active site: K53 (= K59), S74 (≠ R85), E200 (≠ V210), A204 (= A214), D206 (≠ A216), G229 (= G238), L302 (= L309), S303 (= S310)
- binding adenosine-5'-triphosphate: S28 (≠ W34), S29 (≠ P35), I30 (≠ L36), K48 (≠ P54), T49 (= T55), Q79 (= Q90), Y111 (≠ L122), E266 (≠ I276), R267 (≠ A277), K269 (≠ H279), N306 (= N313)
- binding magnesium ion: E200 (≠ V210), A204 (= A214), D206 (≠ A216)
- binding malonate ion: K53 (= K59), S73 (≠ T84), S74 (≠ R85), N76 (= N87), H77 (= H88), R125 (= R137), G229 (= G238), S232 (≠ C241)
Query Sequence
>HSERO_RS09030 FitnessBrowser__HerbieS:HSERO_RS09030
MSHAARTLLPSLTDIEQAAGIVYAGMAPTAQLCWPLLNQALGAEVWVKHENHAPTGAFKV
RGGMVYLHHLARQQPQLSGVVSATRGNHGQSVGLAARRLGISATIVVPQGNSREKNAAMR
ALGVELIEHGSEFQESREYAQQLAAQQQLHMIPSLHRDLVAGVASYWMELFAAQPGLDVV
LVPIGQGSGMCGAVAARNALGLSTRIIGVVSAHALAYKLSFEAGRKIESPVSTCIADGVA
CRVPDQASLEVLFSEVDEVVAVTDDEVMDAMKLAYIATHNVAEGAGACALAAAWQLRARL
RGLKVGVTLSGGNVDHDVLARVLARAAAPADMLLAPAQVLPLTSLPQRRSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory