SitesBLAST
Comparing HSERO_RS09050 FitnessBrowser__HerbieS:HSERO_RS09050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
45% identity, 98% coverage: 8:398/398 of query aligns to 3:394/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I22 (= I25), R23 (= R26), G39 (= G42), G40 (= G43), G99 (= G107), S100 (= S108), Q101 (= Q109), Y125 (= Y133), N174 (= N180), D202 (= D208), Y205 (= Y211), S235 (= S237), S237 (= S239), K238 (= K240), R245 (= R247), R368 (= R372)
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
45% identity, 98% coverage: 8:398/398 of query aligns to 3:394/397 of Q72LL6
- S20 (= S23) mutation to E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- R23 (= R26) mutation to A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; mutation to Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- G40 (= G43) binding
- Y70 (= Y73) binding
- N174 (= N180) binding ; binding
- R245 (= R247) binding
- R368 (= R372) binding
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
45% identity, 97% coverage: 13:398/398 of query aligns to 6:390/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: I18 (= I25), R19 (= R26), G35 (= G42), G36 (= G43), G95 (= G107), S96 (= S108), Q97 (= Q109), Y121 (= Y133), N170 (= N180), D198 (= D208), Y201 (= Y211), S231 (= S237), S233 (= S239), K234 (= K240), R241 (= R247), R364 (= R372)
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
45% identity, 97% coverage: 13:398/398 of query aligns to 6:390/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G107), S96 (= S108), Q97 (= Q109), Y121 (= Y133), N170 (= N180), D198 (= D208), A200 (≠ P210), Y201 (= Y211), S231 (= S237), S233 (= S239), K234 (= K240), R241 (= R247)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
42% identity, 97% coverage: 13:398/398 of query aligns to 10:402/404 of 3wx9A
- binding 4-(2-aminophenyl)-2,4-dioxobutanoic acid: R23 (= R26), G40 (= G43), L41 (= L44)
- binding 2-oxoglutaric acid: D213 (= D209), P214 (= P210), Y215 (= Y211), G216 (= G212), E217 (≠ A213), G241 (= G236), T242 (≠ S237), I246 (≠ V241)
- binding (2E)-pent-2-enedioic acid: G40 (= G43), Y130 (= Y133), N184 (= N180), R376 (= R372)
- binding glutamic acid: S20 (= S23), V22 (≠ I25), L131 (= L134), V360 (= V356), A364 (≠ P360), R369 (≠ V365)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G107), S105 (= S108), Q106 (= Q109), Y130 (= Y133), N184 (= N180), D212 (= D208), P214 (= P210), Y215 (= Y211), T242 (≠ S237), S244 (= S239), K245 (= K240), R252 (= R247)
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
42% identity, 97% coverage: 13:398/398 of query aligns to 10:402/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: S20 (= S23), V22 (≠ I25), R23 (= R26), L131 (= L134), Q135 (= Q138), A364 (≠ P360), R369 (≠ V365)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: R23 (= R26), G40 (= G43), Y130 (= Y133), L131 (= L134), A132 (≠ G135), N184 (= N180), R376 (= R372)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G107), S105 (= S108), Q106 (= Q109), Y130 (= Y133), V179 (≠ L175), N184 (= N180), D212 (= D208), P214 (= P210), Y215 (= Y211), T242 (≠ S237), S244 (= S239), K245 (= K240), R252 (= R247)
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
42% identity, 97% coverage: 13:398/398 of query aligns to 10:402/404 of 3aowC
- binding 2-oxoglutaric acid: R23 (= R26), Y70 (= Y73), Y130 (= Y133), L275 (= L270)
- binding pyridoxal-5'-phosphate: G104 (= G107), S105 (= S108), Q106 (= Q109), Y130 (= Y133), V179 (≠ L175), N184 (= N180), D212 (= D208), P214 (= P210), Y215 (= Y211), T242 (≠ S237), S244 (= S239), K245 (= K240), R252 (= R247)
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
42% identity, 97% coverage: 13:398/398 of query aligns to 10:402/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G107), S105 (= S108), Q106 (= Q109), Y130 (= Y133), V179 (≠ L175), N184 (= N180), D212 (= D208), P214 (= P210), Y215 (= Y211), T242 (≠ S237), S244 (= S239), K245 (= K240), R252 (= R247)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
42% identity, 97% coverage: 13:398/398 of query aligns to 7:400/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G107), S103 (= S108), Q104 (= Q109), Y128 (= Y133), V177 (≠ L175), N182 (= N180), D210 (= D208), P212 (= P210), Y213 (= Y211), T240 (≠ S237), S242 (= S239), K243 (= K240), R250 (= R247)
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
44% identity, 98% coverage: 9:398/398 of query aligns to 1:386/389 of 2z1yA
- binding leucine: G32 (= G43), Y117 (= Y133), R360 (= R372)
- binding pyridoxal-5'-phosphate: G91 (= G107), S92 (= S108), Q93 (= Q109), Y117 (= Y133), N166 (= N180), D194 (= D208), Y197 (= Y211), S227 (= S237), S229 (= S239), K230 (= K240), R237 (= R247)
1vp4A Crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution
35% identity, 97% coverage: 9:394/398 of query aligns to 12:410/420 of 1vp4A
- binding pyridoxal-5'-phosphate: G112 (= G107), S113 (= S108), Q114 (= Q109), Y138 (= Y133), N194 (= N180), D222 (= D208), P224 (= P210), Y225 (= Y211), T252 (≠ S237), S254 (= S239), K255 (= K240), R262 (= R247)
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
33% identity, 97% coverage: 13:398/398 of query aligns to 7:405/405 of 2zc0A
- active site: Y132 (= Y133), D214 (= D208), A216 (≠ P210), S246 (= S239)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G107), G107 (≠ S108), T108 (≠ Q109), Y132 (= Y133), N186 (= N180), D214 (= D208), A216 (≠ P210), Y217 (= Y211), T244 (≠ S237), S246 (= S239), K247 (= K240), R254 (= R247)
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
31% identity, 91% coverage: 35:398/398 of query aligns to 20:414/414 of 2vgzA
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: G39 (= G43), L40 (= L44), Y74 (= Y73), S117 (= S108), Q118 (= Q109), Y142 (= Y133), N202 (= N180), D230 (= D208), P232 (= P210), Y233 (= Y211), S260 (= S237), S262 (= S239), K263 (= K240), R270 (= R247), R399 (= R372)
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I25), R20 (= R26), T23 (≠ L29), G39 (= G43), L40 (= L44), Y74 (= Y73), S75 (≠ G74), S77 (≠ T76), S117 (= S108), Q118 (= Q109), Y142 (= Y133), N202 (= N180), D230 (= D208), P232 (= P210), Y233 (= Y211), S260 (= S237), S262 (= S239), R270 (= R247), L293 (= L270), R399 (= R372)
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: I19 (= I25), G39 (= G43), Y74 (= Y73), S75 (≠ G74), S77 (≠ T76), S117 (= S108), Q118 (= Q109), Y142 (= Y133), N202 (= N180), D230 (= D208), P232 (= P210), Y233 (= Y211), S260 (= S237), S262 (= S239), R270 (= R247), L293 (= L270), R399 (= R372)
4gdyB Kynurenine aminotransferase ii inhibitors
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: I19 (= I25), M33 (≠ I37), G39 (= G43), Y74 (= Y73), S75 (≠ G74), G116 (= G107), S117 (= S108), Q118 (= Q109), Y142 (= Y133), N202 (= N180), D230 (= D208), P232 (= P210), S260 (= S237), S262 (= S239), R270 (= R247), R399 (= R372)
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
31% identity, 95% coverage: 19:398/398 of query aligns to 16:428/428 of 6t8qA
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/425 of 5tf5A
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
31% identity, 95% coverage: 19:398/398 of query aligns to 13:425/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: I19 (= I25), R20 (= R26), Y142 (= Y133), R399 (= R372)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (= S108), Q118 (= Q109), Y142 (= Y133), N202 (= N180), D230 (= D208), P232 (= P210), Y233 (= Y211), S260 (= S237), S262 (= S239), K263 (= K240), R270 (= R247)
Query Sequence
>HSERO_RS09050 FitnessBrowser__HerbieS:HSERO_RS09050
MKLENPAPLQWQFSQRADAMKSSAIREILKVTMRPDITSFAGGLPSPLTFPVEHMKTAFD
RVLSQQGKMALQYGPTDGYLPLREWIAASLSTNGAQISAEQVLMVSGSQQGLDLLGKVLI
DEGSKVLVETPSYLGALQAFALYGAKFESVPSDEFGLQPETIEAIAGGARMLYSLPNFQN
PTGRTLPTERRFKLVETCARLGLPLIEDDPYGALSYQNAPLPKMLSMNPSGVIYMGSFSK
VLTPGIRLGYVVAPRPLILKMEQAKQATDLHTAQLTQMVVYEAIKDGFLDQHVPTIRKLY
GDQCQAMLDALQQYFPASCSWSKPEGGMFIWVTLPEHIDAGALLNEAVEQEKVAFVPGAP
FYANVAQKNTLRLSFVTVPPEQIRAGVERLGKLIASKL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory