SitesBLAST
Comparing HSERO_RS10045 FitnessBrowser__HerbieS:HSERO_RS10045 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3enkA 1.9a crystal structure of udp-glucose 4-epimerase from burkholderia pseudomallei
63% identity, 96% coverage: 2:331/343 of query aligns to 3:332/340 of 3enkA
- active site: S127 (= S126), S128 (= S127), T130 (= T129), Y152 (= Y151), K156 (= K155)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), G14 (= G13), Y15 (= Y14), I16 (= I15), D35 (= D34), N36 (= N35), V38 (≠ C37), N39 (= N38), S40 (= S39), D62 (= D61), V63 (≠ I62), F84 (= F83), A85 (= A84), A86 (≠ G85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-5'-diphosphate-glucose: T130 (= T129), N182 (= N181), N201 (= N200), N202 (= N201), L203 (= L202), R219 (≠ S218), V220 (= V219), F221 (≠ Y220), R234 (= R233), Y236 (= Y235), V272 (= V271), R295 (= R294), D298 (= D297)
7xpqA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glcnac (see paper)
62% identity, 96% coverage: 5:332/343 of query aligns to 3:336/343 of 7xpqA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D61), L63 (≠ I62), F84 (= F83), A85 (= A84), G86 (= G85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: N182 (= N181), N202 (= N201), L203 (= L202), T219 (≠ S218), Y221 (= Y220), R234 (= R233), Y236 (= Y235), V275 (= V271), R298 (= R294), D301 (= D297)
7xpoA Crystal structure of udp-glc/glcnac 4-epimerase with NAD/udp-glc (see paper)
62% identity, 96% coverage: 5:332/343 of query aligns to 3:336/344 of 7xpoA
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), N36 (= N38), D62 (= D61), L63 (≠ I62), F84 (= F83), A85 (= A84), G86 (= G85), K88 (= K87), N103 (= N102), S126 (= S125), S128 (= S127), Y152 (= Y151), K156 (= K155), Y180 (= Y179), P183 (= P182)
- binding uridine-5'-diphosphate-glucose: S128 (= S127), A129 (= A128), F181 (= F180), N182 (= N181), N202 (= N201), L203 (= L202), T219 (≠ S218), V220 (= V219), Y221 (= Y220), R234 (= R233), Y236 (= Y235), V275 (= V271), R298 (= R294), D301 (= D297)
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 2udpA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), S122 (= S125), S124 (= S127), Y149 (= Y151), K153 (= K155), Y177 (= Y179)
- binding phenyl-uridine-5'-diphosphate: N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ S218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1udcA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), S122 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-mannose: T126 (= T129), Y149 (= Y151), N179 (= N181), N199 (= N201), L200 (= L202), L215 (= L217), A216 (≠ S218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294)
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of P09147
- YI 11:12 (= YI 14:15) binding
- DNLCNS 31:36 (= DNLCNS 34:39) binding
- DI 58:59 (= DI 61:62) binding
- FAGLK 80:84 (= FAGLK 83:87) binding
- N99 (= N102) binding
- S124 (= S127) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y151) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K155) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
- F178 (= F180) binding
- Y299 (≠ C301) mutation to C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1udaA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), S122 (= S125), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (= T129), N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ S218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), R292 (= R294), D295 (= D297), Y299 (≠ C301)
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1naiA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding 1,3-propandiol: N35 (= N38), K84 (= K87), E191 (= E193), P193 (= P195)
- binding uridine-5'-diphosphate: N179 (= N181), N199 (= N201), L200 (= L202), L215 (= L217), A216 (≠ S218), R231 (= R233), Y233 (= Y235), R292 (= R294)
1lrjA Crystal structure of e. Coli udp-galactose 4-epimerase complexed with udp-n-acetylglucosamine (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1lrjA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), L33 (= L36), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: V86 (= V89), S124 (= S127), F178 (= F180), N179 (= N181), L200 (= L202), L215 (= L217), A216 (≠ S218), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1kvrA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1kvrA
- active site: A124 (≠ S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155), M189 (≠ I191)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), S122 (= S125), S123 (= S126), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate: N179 (= N181), N198 (= N200), N199 (= N201), L200 (= L202), A216 (≠ S218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), V269 (= V271), R292 (= R294), D295 (= D297)
1a9yA Udp-galactose 4-epimerase mutant s124a/y149f complexed with udp- glucose (see paper)
59% identity, 95% coverage: 6:332/343 of query aligns to 3:330/338 of 1a9yA
- active site: A124 (≠ S127), A125 (= A128), T126 (= T129), F149 (≠ Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), Y11 (= Y14), I12 (= I15), D31 (= D34), N32 (= N35), C34 (= C37), N35 (= N38), S36 (= S39), D58 (= D61), I59 (= I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), S122 (= S125), S123 (= S126), F149 (≠ Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-glucose: A125 (= A128), T126 (= T129), N179 (= N181), N199 (= N201), L200 (= L202), A216 (≠ S218), I217 (≠ V219), F218 (≠ Y220), R231 (= R233), Y233 (= Y235), R292 (= R294), D295 (= D297), Y299 (≠ C301)
1hzjA Human udp-galactose 4-epimerase: accommodation of udp-n- acetylglucosamine within the active site (see paper)
57% identity, 95% coverage: 6:331/343 of query aligns to 4:336/345 of 1hzjA
- active site: S131 (= S127), A132 (= A128), T133 (= T129), Y156 (= Y151), K160 (= K155)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ C37), N36 (= N38), D65 (= D61), I66 (= I62), F87 (= F83), A88 (= A84), G89 (= G85), K91 (= K87), S129 (= S125), S131 (= S127), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ S218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
57% identity, 96% coverage: 4:332/343 of query aligns to 1:329/335 of 6k0iA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ Y14), I12 (= I15), D31 (= D34), N32 (= N35), N35 (= N38), S36 (= S39), D58 (= D61), V59 (≠ I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), N99 (= N102), S122 (= S125), S123 (= S126), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate-glucose: K84 (= K87), S124 (= S127), Y149 (= Y151), F178 (= F180), N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ S218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
57% identity, 96% coverage: 4:332/343 of query aligns to 1:329/335 of 6k0hA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ Y14), I12 (= I15), D31 (= D34), N32 (= N35), G34 (≠ C37), N35 (= N38), S36 (= S39), D58 (= D61), V59 (≠ I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), N99 (= N102), S123 (= S126), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (= K87), S124 (= S127), Y149 (= Y151), F178 (= F180), N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ S218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
57% identity, 96% coverage: 4:332/343 of query aligns to 1:329/335 of 6k0gA
- active site: S124 (= S127), A125 (= A128), T126 (= T129), Y149 (= Y151), K153 (= K155)
- binding magnesium ion: E66 (≠ D69), H114 (= H117)
- binding nicotinamide-adenine-dinucleotide: G7 (= G10), G10 (= G13), F11 (≠ Y14), I12 (= I15), D31 (= D34), N32 (= N35), N35 (= N38), S36 (= S39), D58 (= D61), V59 (≠ I62), F80 (= F83), A81 (= A84), G82 (= G85), K84 (= K87), N99 (= N102), S122 (= S125), S123 (= S126), Y149 (= Y151), K153 (= K155), Y177 (= Y179), P180 (= P182)
- binding uridine-5'-diphosphate: N179 (= N181), A198 (≠ N200), N199 (= N201), L200 (= L202), Q216 (≠ S218), V217 (= V219), Y218 (= Y220), R231 (= R233), Y233 (= Y235), V268 (= V271), R291 (= R294), D294 (= D297)
1i3lA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
57% identity, 95% coverage: 6:331/343 of query aligns to 4:336/347 of 1i3lA
- active site: S131 (= S127), A132 (= A128), T133 (= T129), Y156 (= Y151), K160 (= K155)
- binding galactose-uridine-5'-diphosphate: N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ S218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ C37), N36 (= N38), D65 (= D61), I66 (= I62), F87 (= F83), A88 (= A84), G89 (= G85), K91 (= K87), S129 (= S125), S130 (= S126), S131 (= S127), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
1i3kA Molecular basis for severe epimerase-deficiency galactosemia: x-ray structure of the human v94m-substituted udp-galactose 4-epimerase (see paper)
57% identity, 95% coverage: 6:331/343 of query aligns to 4:336/347 of 1i3kA
- active site: S131 (= S127), A132 (= A128), T133 (= T129), Y156 (= Y151), K160 (= K155)
- binding nicotinamide-adenine-dinucleotide: G8 (= G10), G11 (= G13), Y12 (= Y14), I13 (= I15), D32 (= D34), N33 (= N35), H35 (≠ C37), N36 (= N38), D65 (= D61), I66 (= I62), F87 (= F83), A88 (= A84), G89 (= G85), K91 (= K87), S129 (= S125), S131 (= S127), Y156 (= Y151), K160 (= K155), Y184 (= Y179), P187 (= P182)
- binding uridine-5'-diphosphate-glucose: F185 (= F180), N186 (= N181), N206 (= N201), L207 (= L202), N223 (≠ S218), V224 (= V219), F225 (≠ Y220), R238 (= R233), Y240 (= Y235), V276 (= V271), R299 (= R294), D302 (= D297)
Q14376 UDP-glucose 4-epimerase; Galactowaldenase; UDP-N-acetylgalactosamine 4-epimerase; UDP-GalNAc 4-epimerase; UDP-N-acetylglucosamine 4-epimerase; UDP-GlcNAc 4-epimerase; UDP-galactose 4-epimerase; EC 5.1.3.2; EC 5.1.3.7 from Homo sapiens (Human) (see 13 papers)
57% identity, 95% coverage: 6:331/343 of query aligns to 5:337/348 of Q14376
- GYI 12:14 (= GYI 13:15) binding
- DNFHN 33:37 (≠ DNLCN 34:38) binding
- N34 (= N35) to S: in GALAC3; peripheral; nearly normal activity towards UDP-galactose; dbSNP:rs121908046
- DI 66:67 (= DI 61:62) binding
- F88 (= F83) binding
- G90 (= G85) to E: in GALAC3; 800-fold decrease in UDP-galactose epimerization activity; dbSNP:rs28940882
- K92 (= K87) binding
- V94 (= V89) to M: in GALAC3; generalized; 30-fold decrease in UDP-galactose epimerization activity; 2-fold decrease in affinity for UDP-galactose; 24% of normal activity with respect to UDP-N-acetylgalactosamine; dbSNP:rs121908047
- D103 (≠ R98) to G: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs28940883
- S132 (= S127) mutation to A: Loss of activity.
- SAT 132:134 (= SAT 127:129) binding
- Y157 (= Y151) active site, Proton acceptor; mutation to F: Loss of activity.
- K161 (= K155) binding
- A180 (≠ I174) to V: in dbSNP:rs3204468
- L183 (= L177) to P: in GALAC3; peripheral; 3-fold decrease in UDP-galactose epimerization activity; dbSNP:rs121908045
- Y185 (= Y179) binding
- YFN 185:187 (= YFN 179:181) binding
- NNL 206:208 (= NNL 200:202) binding
- NVF 224:226 (≠ SVY 218:220) binding
- R239 (= R233) binding
- K257 (= K251) to R: in GALAC3; 7-fold decrease in UDP-galactose epimerization activity; does not affect affinity for UDP-galactose; dbSNP:rs28940884
- REGD 300:303 (≠ RPGD 294:297) binding
- C307 (= C301) mutation to Y: No effect on activity towards UDP-galactose. Loss of activity towards UDP-N-acetylgalactosamine.
- L313 (≠ R307) to M: in GALAC3; 6-fold decrease in UDP-galactose epimerization activity; very mild decrease in activity towards UDP-N-acetylgalactosamine; dbSNP:rs3180383
- G319 (= G313) to E: in GALAC3; nearly normal activity towards UDP-galactose; mild impairment under conditions of substrate limitation; dbSNP:rs28940885
- R335 (= R329) to H: in GALAC3; 2-fold decrease in UDP-galactose epimerization activity; dbSNP:rs368637540
1ek6A Structure of human udp-galactose 4-epimerase complexed with nadh and udp-glucose (see paper)
57% identity, 95% coverage: 6:331/343 of query aligns to 5:337/346 of 1ek6A
- active site: S132 (= S127), A133 (= A128), T134 (= T129), Y157 (= Y151), K161 (= K155)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), N34 (= N35), H36 (≠ C37), N37 (= N38), D66 (= D61), I67 (= I62), F88 (= F83), A89 (= A84), G90 (= G85), K92 (= K87), S130 (= S125), S131 (= S126), S132 (= S127), Y157 (= Y151), K161 (= K155), Y185 (= Y179), P188 (= P182)
- binding uridine-5'-diphosphate-glucose: S132 (= S127), Y157 (= Y151), F186 (= F180), N187 (= N181), N207 (= N201), L208 (= L202), N224 (≠ S218), V225 (= V219), F226 (≠ Y220), R239 (= R233), Y241 (= Y235), V277 (= V271), R300 (= R294), D303 (= D297)
7kn1A Crystal structure of udp-glucose-4-epimerase (gale) from stenotrophomonas maltophila with bound NAD and formylated udp- arabinopyranose
54% identity, 97% coverage: 6:336/343 of query aligns to 5:335/336 of 7kn1A
- active site: S126 (= S127), Y150 (= Y151), K154 (= K155)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), G12 (= G13), Y13 (= Y14), I14 (= I15), D33 (= D34), S34 (≠ N35), C36 (= C37), N37 (= N38), D60 (= D61), I61 (= I62), F82 (= F83), A83 (= A84), A84 (≠ G85), K86 (= K87), S124 (= S125), S125 (= S126), S126 (= S127), Y150 (= Y151), K154 (= K155), Y178 (= Y179), P181 (= P182)
- binding UDP-4-deoxy-4-formamido-beta-L-arabinopyranose: V88 (= V89), S126 (= S127), Y150 (= Y151), N180 (= N181), S199 (≠ N200), N200 (= N201), L201 (= L202), Q217 (≠ S218), V218 (= V219), F219 (≠ Y220), R232 (= R233), Y234 (= Y235), V270 (= V271), R293 (= R294), D296 (= D297)
Query Sequence
>HSERO_RS10045 FitnessBrowser__HerbieS:HSERO_RS10045
MTQATILVTGGAGYIGSHTCVELIHAGYAVVVLDNLCNSRASVIDRIAQISGQRPHFVQG
DIRDRAVLDGIFKSHRIEAVIHFAGLKAVGESVAQPLRYYDNNVHGSNVLFEAMAAHGVK
NIVFSSSATVYGDPASVPITEEFPLSATNPYGRSKLMVEQILGDLHVADPSWRIALLRYF
NPVGAHESGLIGEDPSGIPNNLLPFIAQVADGRRAALSVYGSDYPTPDGTGVRDYIHVVD
LALGHLKTLRKLEQGPGVYTYNLGTGRGNSVLEMLAAFEQACGNKLPYQLVDRRPGDIAC
CYAATERAERELGWRAQRGIEAMCADTWRWQALAKRLAQEEAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory