Comparing HSERO_RS10090 FitnessBrowser__HerbieS:HSERO_RS10090 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
37% identity, 97% coverage: 1:273/282 of query aligns to 12:283/287 of 3pduA
Sites not aligning to the query:
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
35% identity, 98% coverage: 1:277/282 of query aligns to 12:287/287 of 3pefA
Sites not aligning to the query:
2uyyA Structure of the cytokine-like nuclear factor n-pac
28% identity, 97% coverage: 1:274/282 of query aligns to 17:289/292 of 2uyyA
Sites not aligning to the query:
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
28% identity, 97% coverage: 1:274/282 of query aligns to 278:550/553 of Q49A26
Sites not aligning to the query:
Q922P9 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Putative oxidoreductase GLYR1 from Mus musculus (Mouse) (see paper)
29% identity, 97% coverage: 1:274/282 of query aligns to 277:543/546 of Q922P9
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
31% identity, 96% coverage: 1:271/282 of query aligns to 12:282/298 of P0A9V8
Sites not aligning to the query:
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
31% identity, 96% coverage: 1:271/282 of query aligns to 11:281/295 of 6smzC
Sites not aligning to the query:
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
31% identity, 96% coverage: 1:271/282 of query aligns to 11:281/294 of 6smyA
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
26% identity, 96% coverage: 1:271/282 of query aligns to 49:325/335 of P29266
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
27% identity, 96% coverage: 1:271/282 of query aligns to 50:326/336 of P31937
Sites not aligning to the query:
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
27% identity, 96% coverage: 1:271/282 of query aligns to 11:287/296 of 2i9pB
Sites not aligning to the query:
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
24% identity, 99% coverage: 1:278/282 of query aligns to 14:292/294 of 5je8B
Sites not aligning to the query:
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
33% identity, 84% coverage: 1:237/282 of query aligns to 11:250/291 of 5y8hA
Sites not aligning to the query:
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
29% identity, 96% coverage: 1:271/282 of query aligns to 24:290/293 of 3ws7A
Sites not aligning to the query:
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
33% identity, 84% coverage: 1:237/282 of query aligns to 11:250/292 of 5y8iA
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
33% identity, 84% coverage: 1:237/282 of query aligns to 12:251/290 of 5y8lB
Sites not aligning to the query:
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
33% identity, 84% coverage: 1:237/282 of query aligns to 12:251/290 of 5y8kA
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
29% identity, 96% coverage: 1:271/282 of query aligns to 24:293/296 of 3w6zA
Sites not aligning to the query:
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
24% identity, 93% coverage: 1:263/282 of query aligns to 326:590/602 of Q8T079
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 83% coverage: 1:233/282 of query aligns to 11:248/294 of 3q3cA
Sites not aligning to the query:
>HSERO_RS10090 FitnessBrowser__HerbieS:HSERO_RS10090
MGFPMAANLVRAGYAVRAWNRSPAPVERLAALGAQAAATPAEAAADADVLISMLADDDAT
ETSLLDAGALAALRPGAIHVNMATISVALALRLAGLHQARGVAYVAAPVLGRVNVAEAGQ
LNILAAGEEQALAAVQPLLDVLGQKTWRLGRQPEQANAAKLAMNFMIASAIGAMSEAVAL
VQGYGLDKAGFIELATSTAFAAPVYKGYGQAIADDRFEPAGFKLALGLKDVRLALEAGEQ
AHVPLSLASALRDLHIDGLAHGEGHLDWAALSRASARRAGQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory