Comparing HSERO_RS10775 HSERO_RS10775 cysteine ABC transporter substrate-binding protein to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
43% identity, 83% coverage: 37:257/267 of query aligns to 4:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
42% identity, 83% coverage: 37:257/267 of query aligns to 4:226/226 of 4zv1A
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
37% identity, 87% coverage: 30:260/267 of query aligns to 6:234/237 of 3vv5A
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
37% identity, 87% coverage: 30:260/267 of query aligns to 10:238/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
37% identity, 87% coverage: 30:260/267 of query aligns to 10:238/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
37% identity, 87% coverage: 30:260/267 of query aligns to 10:238/241 of 3vvdA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
38% identity, 85% coverage: 30:256/267 of query aligns to 3:228/229 of 5t0wA
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
40% identity, 87% coverage: 29:261/267 of query aligns to 6:238/240 of 2ylnA
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
32% identity, 84% coverage: 38:260/267 of query aligns to 27:257/260 of P0AEU0
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
33% identity, 85% coverage: 30:256/267 of query aligns to 3:227/229 of 6svfA
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
32% identity, 83% coverage: 39:260/267 of query aligns to 28:257/260 of P02910
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
32% identity, 83% coverage: 39:260/267 of query aligns to 6:235/238 of 1hslA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
32% identity, 84% coverage: 38:260/267 of query aligns to 27:257/260 of P02911
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 84% coverage: 38:260/267 of query aligns to 2:232/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
32% identity, 84% coverage: 38:260/267 of query aligns to 5:235/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 84% coverage: 38:260/267 of query aligns to 5:235/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 84% coverage: 38:260/267 of query aligns to 5:235/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
32% identity, 84% coverage: 38:260/267 of query aligns to 5:235/238 of 1lafE
5otaA Structure of the periplasmic binding protein (pbp) noct from agrobacterium tumefaciens c58 in complex with octopinic acid (see paper)
32% identity, 84% coverage: 38:261/267 of query aligns to 3:253/254 of 5otaA
5ot9A Structure of the periplasmic binding protein (pbp) noct from a.Tumefaciens c58 in complex with histopine. (see paper)
32% identity, 84% coverage: 38:261/267 of query aligns to 3:253/254 of 5ot9A
>HSERO_RS10775 HSERO_RS10775 cysteine ABC transporter substrate-binding protein
MNKNIKQWLLAGVGAALLASSLSVSAADLLQSVKSSGTLKVALEGNYPPFNFKDPKTGEL
TGFEVDVAKLLAAKLGVKPVFTTTEWSGILAGLGAGKYDVIINQVGITDERQKAFDFSDP
YTLSSAQLIVRKDEKREFKSLEDLKGKKLGLGQGTNFEQKAKAVPGIDVRTYPGSPEYLA
DLAAGRIDAALNDSLLVGYILKSTNLPLKAGSPIGAVDKIGIPFRKGNPEFKAALNKALA
DIKADGSFKAASEKWFGIDVSQPPKAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory