Comparing HSERO_RS10790 FitnessBrowser__HerbieS:HSERO_RS10790 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4o23A Crystal structure of mono-zinc form of succinyl diaminopimelate desuccinylase from neisseria meningitidis mc58 (see paper)
62% identity, 100% coverage: 2:375/375 of query aligns to 3:376/376 of 4o23A
4pqaA Crystal structure of succinyl-diaminopimelate desuccinylase from neisseria meningitidis mc58 in complex with the inhibitor captopril (see paper)
62% identity, 99% coverage: 2:374/375 of query aligns to 3:375/375 of 4pqaA
7t1qA Crystal structure of the succinyl-diaminopimelate desuccinylase (dape) from acinetobacter baumannii in complex with succinic acid
61% identity, 96% coverage: 16:375/375 of query aligns to 17:376/377 of 7t1qA
5vo3A Crystal structure of dape in complex with the products (succinic acid and diaminopimelic acid) (see paper)
52% identity, 99% coverage: 3:374/375 of query aligns to 8:379/380 of 5vo3A
P44514 Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 3 papers)
52% identity, 99% coverage: 3:374/375 of query aligns to 4:375/377 of P44514
7lgpB Dape enzyme from shigella flexneri
52% identity, 99% coverage: 4:375/375 of query aligns to 7:377/377 of 7lgpB
4op4B Crystal structure of the catalytic domain of dape protein from v.Cholerea in the zn bound form (see paper)
61% identity, 47% coverage: 2:179/375 of query aligns to 3:180/265 of 4op4B
Sites not aligning to the query:
4h2kA Crystal structure of the catalytic domain of succinyl-diaminopimelate desuccinylase from haemophilus influenzae (see paper)
55% identity, 49% coverage: 3:185/375 of query aligns to 6:186/258 of 4h2kA
Sites not aligning to the query:
7uoiA Crystallographic structure of dape from enterococcus faecium
25% identity, 96% coverage: 3:363/375 of query aligns to 9:372/383 of 7uoiA
7rsfA Acetylornithine deacetylase from escherichia coli
25% identity, 92% coverage: 28:373/375 of query aligns to 36:377/380 of 7rsfA
3pfoA Crystal structure of a putative acetylornithine deacetylase (rpa2325) from rhodopseudomonas palustris cga009 at 1.90 a resolution
23% identity, 95% coverage: 1:356/375 of query aligns to 18:403/426 of 3pfoA
Q03154 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Homo sapiens (Human) (see 6 papers)
25% identity, 99% coverage: 4:373/375 of query aligns to 12:398/408 of Q03154
2pokA Crystal structure of a m20 family metallo peptidase from streptococcus pneumoniae
27% identity, 50% coverage: 11:196/375 of query aligns to 30:222/458 of 2pokA
Sites not aligning to the query:
P37111 Aminoacylase-1; ACY-1; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14 from Sus scrofa (Pig) (see paper)
25% identity, 99% coverage: 4:373/375 of query aligns to 12:397/407 of P37111
Sites not aligning to the query:
Q8C165 N-fatty-acyl-amino acid synthase/hydrolase PM20D1; Peptidase M20 domain-containing protein 1; PM20D1; EC 3.5.1.114; EC 3.5.1.14 from Mus musculus (Mouse) (see paper)
33% identity, 38% coverage: 56:197/375 of query aligns to 116:262/503 of Q8C165
Sites not aligning to the query:
Q96KN2 Beta-Ala-His dipeptidase; CNDP dipeptidase 1; Carnosine dipeptidase 1; Glutamate carboxypeptidase-like protein 2; Serum carnosinase; EC 3.4.13.20 from Homo sapiens (Human) (see 4 papers)
30% identity, 36% coverage: 54:188/375 of query aligns to 124:254/507 of Q96KN2
Sites not aligning to the query:
3dljA Crystal structure of human carnosine dipeptidase 1
32% identity, 29% coverage: 54:162/375 of query aligns to 93:197/471 of 3dljA
Sites not aligning to the query:
Q8P8J5 N-acetyl-L-citrulline deacetylase; ACDase; Acetylcitrulline deacetylase; EC 3.5.1.- from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see paper)
27% identity, 88% coverage: 36:365/375 of query aligns to 43:361/366 of Q8P8J5
4mmoA The crystal structure of a m20 family metallo-carboxypeptidase sso-cp2 from sulfolobus solfataricus
30% identity, 21% coverage: 36:114/375 of query aligns to 29:119/437 of 4mmoA
Sites not aligning to the query:
Q9D1A2 Cytosolic non-specific dipeptidase; CNDP dipeptidase 2; Glutamate carboxypeptidase-like protein 1; Threonyl dipeptidase; EC 3.4.13.18 from Mus musculus (Mouse) (see 2 papers)
35% identity, 20% coverage: 61:134/375 of query aligns to 94:167/475 of Q9D1A2
Sites not aligning to the query:
>HSERO_RS10790 FitnessBrowser__HerbieS:HSERO_RS10790
MSKTLALTQELMSLSSVTPEDKGCQARLAELLTPLGFVCETIQSGEVTNLWARKGTAQPL
VVFAGHTDVVPTGPLEKWQSHPFQPTLREGRLYGRGASDMKTSIAAMVVACEEFTAAHPD
HKGSIGFLITSDEEGPAIDGTVVVCNALKARGEQLDYCIVGEPTSAKTLGDMIKNGRRGT
MSGKLTVKGIQGHIAYPQLARNPIHQAAPALAELVAEQWDAGNEYYLPTSWQISNIHGGT
GASNVIPGEVMIDFNFRFSTASTVEGLQQRVHAILDKHGLEYDLKWTVGGLPFLTPRGDL
SDALSKAIKDETGLDTELSTTGGTSDGRFIAQICPQVIEFGPPNDSIHKIDEHIEVRYID
PLKNIYRKTLENLLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory