Comparing HSERO_RS10805 FitnessBrowser__HerbieS:HSERO_RS10805 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3jtxB Crystal structure of aminotransferase (np_283882.1) from neisseria meningitidis z2491 at 1.91 a resolution
53% identity, 99% coverage: 1:397/403 of query aligns to 1:393/393 of 3jtxB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
29% identity, 98% coverage: 4:399/403 of query aligns to 2:387/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
29% identity, 98% coverage: 4:399/403 of query aligns to 2:387/388 of 1gd9A
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
26% identity, 91% coverage: 32:397/403 of query aligns to 20:376/380 of 2x5dD
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
25% identity, 95% coverage: 17:399/403 of query aligns to 23:398/402 of P14909
Sites not aligning to the query:
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
27% identity, 94% coverage: 13:392/403 of query aligns to 21:383/393 of 6l1nA
Sites not aligning to the query:
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
27% identity, 90% coverage: 32:392/403 of query aligns to 35:384/393 of 6l1lB
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
27% identity, 90% coverage: 32:392/403 of query aligns to 35:384/392 of 6l1oB
Sites not aligning to the query:
2o1bA Structure of aminotransferase from staphylococcus aureus
26% identity, 90% coverage: 32:393/403 of query aligns to 22:369/376 of 2o1bA
8wkjA The crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila (see paper)
26% identity, 90% coverage: 32:395/403 of query aligns to 34:389/391 of 8wkjA
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
26% identity, 90% coverage: 32:395/403 of query aligns to 40:381/384 of 1o4sB
1j32A Aspartate aminotransferase from phormidium lapideum
26% identity, 81% coverage: 33:358/403 of query aligns to 34:354/388 of 1j32A
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
24% identity, 92% coverage: 32:400/403 of query aligns to 34:400/400 of 6f35A
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
24% identity, 92% coverage: 32:400/403 of query aligns to 44:410/410 of P58350
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
29% identity, 74% coverage: 32:328/403 of query aligns to 32:327/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
29% identity, 74% coverage: 32:328/403 of query aligns to 32:327/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
28% identity, 74% coverage: 32:328/403 of query aligns to 33:328/404 of 5wmlA
Sites not aligning to the query:
1v2fA Crystal structure of t.Th hb8 glutamine aminotransferase complex with 3-phenylpropionate (see paper)
26% identity, 90% coverage: 32:392/403 of query aligns to 28:364/368 of 1v2fA
Sites not aligning to the query:
1v2eA Crystal structure of t.Th hb8 glutamine aminotransferase complex with a-keto-g-methylthiobutyrate (see paper)
26% identity, 90% coverage: 32:392/403 of query aligns to 28:364/368 of 1v2eA
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
26% identity, 83% coverage: 32:365/403 of query aligns to 34:359/382 of 1b5oA
>HSERO_RS10805 FitnessBrowser__HerbieS:HSERO_RS10805
VNPLLDQLQPYPFEKLKKLFAGITPDPAYRPISLGIGEPKHPTPAFIQQALIDNLAGLAS
YPATLGSDALRGAIADWLQKRYDIPRPDPATEILPVNGSREALFSLTQTVVDPTRPGALV
MCPNPFYQIYEGSAYLAGAQPYFVNSDPKRNFAPDFSQVPQDVWERVQLLFVCSPGNPTG
AVLTLEDWKELFALSDRYGFVIASDECYSEIYFNEDPPLGGMQAARLLGRDYRRLISFSS
LSKRSNVPGMRSGFVAGDAAILKKFLLYRTYHGAAMSPVIQAASVLAWQDETHVQGNIAK
YVTKFSQVTPLLQEVLEVALPDAAFYLWAKVDKLVNISDTEFAQRLYAEYNVTVLPGSYL
AREAHGVNPGAGRIRMALVAEVEECLEAAQRIVAFTRKLAGQA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory