SitesBLAST
Comparing HSERO_RS10830 FitnessBrowser__HerbieS:HSERO_RS10830 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
60% identity, 97% coverage: 4:289/296 of query aligns to 2:280/282 of 5ve7A
- binding uridine 5'-triphosphate: P9 (= P11), V10 (= V12), A11 (= A13), G12 (= G14), G14 (= G16), T15 (≠ S17), R16 (= R18), K26 (= K28), E27 (= E29), Q104 (= Q106), A107 (≠ P109), G109 (= G111), A113 (= A115)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
59% identity, 96% coverage: 4:288/296 of query aligns to 4:285/290 of 5i1fA
- binding uridine-5'-diphosphate-glucose: P11 (= P11), A13 (= A13), G14 (= G14), K28 (= K28), E29 (= E29), Q106 (= Q106), A109 (≠ P109), L110 (= L110), G111 (= G111), L112 (= L112), A115 (= A115), D135 (= D135), Y172 (= Y175), G173 (= G176), E192 (= E195), K193 (= K196), V205 (= V208)
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
51% identity, 97% coverage: 2:287/296 of query aligns to 2:282/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
51% identity, 90% coverage: 5:270/296 of query aligns to 8:271/281 of 8f73E
- binding uridine-5'-diphosphate-glucose: P14 (= P11), A16 (= A13), G17 (= G14), K31 (= K28), E32 (= E29), Q108 (= Q106), G113 (= G111), L114 (= L112), A117 (= A115), L134 (= L132), D137 (= D135), E196 (= E195), K197 (= K196), I209 (≠ V208)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
50% identity, 96% coverage: 5:288/296 of query aligns to 2:286/290 of 6knlA
- binding triphosphate: G13 (= G16), T14 (≠ S17), R15 (= R18), K79 (≠ A82), K81 (= K84)
- binding uridine: P8 (= P11), G11 (= G14), K25 (= K28), Q103 (= Q106), P106 (= P109), G108 (= G111), P130 (≠ A133), D131 (= D134)
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
50% identity, 96% coverage: 5:288/296 of query aligns to 2:286/290 of 6k8dA
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), Q103 (= Q106), P106 (= P109), G108 (= G111), L109 (= L112), A112 (= A115), L129 (= L132), D131 (= D134), E193 (= E195), V206 (= V208)
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
49% identity, 96% coverage: 5:288/296 of query aligns to 2:281/285 of 6ikzB
- binding uridine 5'-triphosphate: P8 (= P11), V9 (= V12), A10 (= A13), G11 (= G14), L12 (= L15), G13 (= G16), T14 (≠ S17), R15 (= R18), K25 (= K28), Q103 (= Q106), P106 (= P109), G108 (= G111), D131 (= D134)
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 5:272/296 of query aligns to 2:259/265 of 3jukA
- binding uridine-5'-diphosphate-glucose: A10 (= A13), G11 (= G14), E26 (= E29), Q94 (= Q106), M97 (≠ P109), G99 (= G111), L100 (= L112), A103 (= A115), D123 (= D135), Y162 (= Y175), G163 (= G176), E182 (= E195), K183 (= K196), V195 (= V208)
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
44% identity, 91% coverage: 5:272/296 of query aligns to 2:259/264 of 3jukD
- binding magnesium ion: T14 (≠ S17), R15 (= R18)
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), E26 (= E29), Q94 (= Q106), M97 (≠ P109), G99 (= G111), L100 (= L112), A103 (= A115), L120 (= L132), D123 (= D135), Y162 (= Y175), G163 (= G176), E182 (= E195), K183 (= K196), V195 (= V208)
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
44% identity, 97% coverage: 2:287/296 of query aligns to 2:249/255 of 2ux8A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
41% identity, 97% coverage: 5:291/296 of query aligns to 3:289/299 of 2pa4B
- binding uridine-5'-diphosphate-glucose: P9 (= P11), A10 (≠ V12), A11 (= A13), G12 (= G14), E27 (= E29), Q103 (= Q106), P106 (= P109), G108 (= G111), L109 (= L112), L131 (= L132), P132 (≠ A133), D134 (= D135), Y170 (= Y175), G171 (= G176), E192 (= E195), K193 (= K196), A205 (≠ V208)
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
39% identity, 96% coverage: 8:290/296 of query aligns to 5:286/291 of 8b6dA
- binding uridine-5'-diphosphate: P8 (= P11), A10 (= A13), G11 (= G14), L12 (= L15), G13 (= G16), T14 (≠ S17), R15 (= R18), K25 (= K28), Q102 (= Q106), A105 (≠ P109), G107 (= G111), A111 (= A115)
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
38% identity, 96% coverage: 8:290/296 of query aligns to 5:281/286 of 8b68A
- binding uridine-5'-diphosphate-glucose: P8 (= P11), A10 (= A13), G11 (= G14), Q102 (= Q106), A105 (≠ P109), G107 (= G111), A111 (= A115), L130 (= L132), P131 (≠ A133), D133 (= D135), A203 (≠ V208), G205 (= G210)
2ggqA Complex of hypothetical glucose-1-phosphate thymidylyltransferase from sulfolobus tokodaii
29% identity, 86% coverage: 7:261/296 of query aligns to 2:210/401 of 2ggqA
- active site: R13 (= R18)
- binding thymidine-5'-triphosphate: L6 (≠ P11), A8 (= A13), G9 (= G14), S10 (≠ L15), G11 (= G16), E12 (≠ S17), R13 (= R18), K23 (= K28), Q73 (≠ R105), G79 (= G111), A83 (= A115), R179 (≠ G230), E181 (= E232)
Sites not aligning to the query:
Q975F9 Bifunctional sugar-1-phosphate nucleotidylyltransferase/acetyltransferase; EC 2.7.7.24; EC 2.7.7.9; EC 2.7.7.83; EC 2.7.7.23; EC 2.3.1.276; EC 2.3.1.157 from Sulfurisphaera tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (Sulfolobus tokodaii) (see 3 papers)
29% identity, 86% coverage: 7:261/296 of query aligns to 2:210/401 of Q975F9
- AGSGER 8:13 (≠ AGLGSR 13:18) binding
- Q73 (≠ R105) binding
- G79 (= G111) binding
- T80 (≠ L112) mutation T->A,G,Q: Increases both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->D,H: Decrease in GlcNAc-1-P UTase activity but increase in Glc-1-P UTase activity.; mutation T->E,K,L,M,R,W,Y: Strong decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.; mutation T->F,I: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation T->N,S: Strong increase in GlcNAc-1-P UTase activity and decrease in Glc-1-P UTase activity.; mutation to N: Loss of GlcNAc-1-P UTase activity; when associated with V-97.
- Y97 (≠ L132) mutation Y->A,D,F,G,I,K,T,V: Increases GlcNAc-1-P UTase activity. Decreases Glc-1-P UTase activity.; mutation Y->C,E,P,R,W: Decreases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation Y->H,L,M,N,Q,S: Increases GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation to V: Loss of GlcNAc-1-P UTase activity; when associated with N-80.
- E146 (= E195) mutation E->A,C,F,G,I,K,L,M,P,Q,R,V,W,Y: Loss of both GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->D,N: Decrease in GlcNAc-1-P UTase and Glc-1-P UTase activities.; mutation E->H,S,T: Decrease in GlcNAc-1-P UTase activity and loss of Glc-1-P UTase activity.
Sites not aligning to the query:
- 308 H→A: Strong decrease in GalN-1-P AcTase activity and almost loss of GlcN-1-P AcTase activity.
- 311 Y→A: Strong decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 331 N→A: Strong decrease in GalN-1-P AcTase activity and decrease in GlcN-1-P AcTase activity.
- 337 K→A: Slight decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 340 K→A: Decrease in GalN-1-P AcTase activity and increase in GlcN-1-P AcTase activity.
- 391:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 38% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 16.8 times. Significantly affects the thermostability of the entire protein.
- 397:401 mutation Missing: No change in GlcNAc-1-P UTase activity. Shows 20% less GalN-1-P AcTase activity than the wild-type, but increases GlcN-1-P AcTase activity 4.8 times. Does not affect thermostability.
5z09A St0452(y97n)-utp binding form (see paper)
30% identity, 86% coverage: 7:261/296 of query aligns to 2:210/401 of 5z09A
- binding uridine 5'-triphosphate: L6 (≠ P11), A7 (≠ V12), A8 (= A13), G9 (= G14), S10 (≠ L15), G11 (= G16), E12 (≠ S17), R13 (= R18), Q73 (≠ R105), G79 (= G111), G98 (≠ D134), D99 (= D135)
4ecmA 2.3 angstrom crystal structure of a glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with thymidine-5-diphospho-alpha-d-glucose and pyrophosphate (see paper)
25% identity, 89% coverage: 7:270/296 of query aligns to 4:232/245 of 4ecmA
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: L8 (≠ P11), G10 (≠ A13), H26 (≠ E29), Q82 (= Q106), A85 (≠ P109), G87 (= G111), I88 (≠ L112), L108 (= L132), D110 (= D134), F144 (≠ Y175), G145 (= G176), E159 (≠ P197), K160 (≠ A198), V170 (= V208)
- binding pyrophosphate 2-: T12 (≠ L15), G13 (= G16), S14 (= S17), R15 (= R18), K25 (= K28)
3hl3A 2.76 angstrom crystal structure of a putative glucose-1-phosphate thymidylyltransferase from bacillus anthracis in complex with a sucrose.
25% identity, 89% coverage: 7:270/296 of query aligns to 3:231/246 of 3hl3A
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
26% identity, 78% coverage: 7:237/296 of query aligns to 2:199/289 of 4ho4A
Sites not aligning to the query:
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
26% identity, 78% coverage: 7:237/296 of query aligns to 2:199/294 of 4ho9A
- binding galactose-uridine-5'-diphosphate: L6 (≠ P11), G8 (≠ A13), G9 (= G14), Q80 (= Q106), P83 (= P109), G85 (= G111), L86 (= L112), L106 (= L132), D108 (= D134), G144 (= G176), E159 (≠ P197), K160 (≠ A198), V170 (= V208), R192 (≠ G230)
- binding uridine 5'-triphosphate: L43 (≠ A48), G113 (≠ D140), H114 (≠ A141), G115 (= G142), T117 (≠ K144)
Sites not aligning to the query:
Query Sequence
>HSERO_RS10830 FitnessBrowser__HerbieS:HSERO_RS10830
MIKKIKKAVFPVAGLGSRFLPATKAQPKEMLPIVDKPLIHYAVEEAVAAGITEMVFITGR
NKRAIEDHFDKAYELESELEAAGKKKLLEIVQNVVPKSVNCIFIRQSVPLGLGHAVLCAR
PVVGEEPFAVLLADDFMDTDAGVKPVLAQMTEIYEREGMSMLAVQEVPQSDTKQYGIVSA
TPYQPNLERVNAIVEKPAPEEAPSTLAVVGRYVLNNRIFDYLENIGRGAGGEIQLTDGIA
KLMQAESVLAYRYQGQRYDCGSKLGYLKATVAMGMKHPETGAAFSEFLKDVAGKQA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory