Comparing HSERO_RS11160 FitnessBrowser__HerbieS:HSERO_RS11160 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
30% identity, 64% coverage: 54:207/239 of query aligns to 42:173/183 of 7yc6A
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
29% identity, 56% coverage: 54:188/239 of query aligns to 67:192/693 of P49915
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
38% identity, 42% coverage: 91:190/239 of query aligns to 73:168/475 of 2ywcA
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
28% identity, 56% coverage: 57:190/239 of query aligns to 48:175/490 of 5tw7F
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
28% identity, 56% coverage: 54:188/239 of query aligns to 45:167/658 of 2vxoB
Sites not aligning to the query:
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
27% identity, 56% coverage: 58:190/239 of query aligns to 51:183/501 of 1gpmA
Sites not aligning to the query:
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
24% identity, 79% coverage: 17:204/239 of query aligns to 8:190/673 of 8hx8A
Sites not aligning to the query:
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
31% identity, 41% coverage: 91:188/239 of query aligns to 79:172/193 of P00900
Sites not aligning to the query:
>HSERO_RS11160 FitnessBrowser__HerbieS:HSERO_RS11160
MPAPVLIIQTGDANPTLKDSYGGYAQQIGCAAGLCQSELQVVTVYEGQRPSCPRSYRAVF
ITGSPAMVTDKEDWSERTAEWLREAAELDTPMFGICYGHQLLTHAFGGEVGYNPAGRAAG
TMHVKTLECCREDELLGVLPPEFPAHMLHMQSVLRPPPDAIVMARSPMDPHHVIKHKHNV
YSTQFHPEFSPEFVRAHLHYYADIYRGCGIDAQALCEKVSDTPQSTGLLRRFLALHARH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory