SitesBLAST
Comparing HSERO_RS11255 FitnessBrowser__HerbieS:HSERO_RS11255 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6b9uA Crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from brucella melitensis complexed with nadh
46% identity, 99% coverage: 3:252/252 of query aligns to 2:244/244 of 6b9uA
- active site: G15 (= G16), S142 (= S142), L152 (= L152), Y155 (= Y155), K159 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G12), S14 (= S15), G15 (= G16), F16 (= F17), D35 (= D36), R36 (≠ I37), A57 (= A61), D58 (= D62), I59 (≠ V63), N85 (= N89), A86 (= A90), V140 (≠ I140), S142 (= S142), Y155 (= Y155), K159 (= K159), A187 (≠ I187), G188 (≠ S188), T190 (= T190), P191 (≠ G191), L192 (= L192), F196 (= F196)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
40% identity, 98% coverage: 2:249/252 of query aligns to 4:241/244 of 4nbuB
- active site: G18 (= G16), N111 (= N114), S139 (= S142), Q149 (≠ L152), Y152 (= Y155), K156 (= K159)
- binding acetoacetyl-coenzyme a: D93 (≠ N96), K98 (≠ E101), S139 (= S142), N146 (≠ R149), V147 (≠ P150), Q149 (≠ L152), Y152 (= Y155), F184 (≠ I187), M189 (≠ L192), K200 (≠ R206)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), N17 (≠ S15), G18 (= G16), I19 (≠ F17), D38 (= D36), F39 (≠ I37), V59 (≠ A61), D60 (= D62), V61 (= V63), N87 (= N89), A88 (= A90), G89 (= G91), I90 (≠ T92), T137 (≠ I140), S139 (= S142), Y152 (= Y155), K156 (= K159), P182 (= P185), F184 (≠ I187), T185 (≠ S188), T187 (= T190), M189 (≠ L192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 98% coverage: 3:249/252 of query aligns to 3:244/248 of 6ixmC
- active site: G16 (= G16), S142 (= S142), Y155 (= Y155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (= I37), A61 (= A61), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), M140 (≠ I140), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ V186), Y187 (≠ I187), I188 (≠ S188), L192 (= L192)
8cxaA Crystal structure of 3-oxoacyl-[acyl-carrier-protein] reductase from mycobacterium smegmatis with bound NAD
37% identity, 99% coverage: 1:249/252 of query aligns to 1:247/251 of 8cxaA
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), Q15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), V63 (= V63), N89 (= N89), A91 (≠ G91), S94 (≠ T92), I142 (= I140), S143 (≠ A141), S144 (= S142), Y157 (= Y155), K161 (= K159), P187 (= P185), H188 (≠ T190), I190 (≠ L192), I194 (≠ F196)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4urfB
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M215), R211 (≠ G216), R212 (= R217)
- binding bicarbonate ion: I92 (≠ T92), G94 (≠ H94), R109 (= R109), R179 (= R179), S228 (= S233)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G14 (= G14), N15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (= I37), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), G91 (= G91), I140 (= I140), Y155 (= Y155), K159 (= K159), P185 (= P185), A186 (≠ V186), I188 (≠ S188), T190 (= T190)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4urfA
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ T92), S93 (≠ T93), G94 (≠ H94), E95 (≠ R95), T97 (≠ R97), E101 (= E101), T103 (≠ E103), Q106 (≠ E106), R109 (= R109), S175 (≠ P175), G177 (≠ K177)
- binding magnesium ion: S237 (≠ V242), Y238 (≠ C243)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G14 (= G14), N15 (≠ S15), G16 (= G16), I17 (≠ F17), D36 (= D36), I37 (= I37), W41 (≠ G41), D62 (= D62), T63 (≠ V63), N89 (= N89), A90 (= A90), G91 (= G91), I140 (= I140), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ S188), T190 (= T190)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
38% identity, 99% coverage: 1:249/252 of query aligns to 1:244/248 of 4ureB
- active site: G16 (= G16), S142 (= S142), I152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ S15), G16 (= G16), I17 (≠ F17), N89 (= N89), G91 (= G91), Y155 (= Y155), P185 (= P185), A186 (≠ V186)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
41% identity, 98% coverage: 3:249/252 of query aligns to 3:247/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), G16 (= G16), I17 (≠ F17), D36 (= D36), L37 (≠ I37), C61 (≠ A61), D62 (= D62), V63 (= V63), N89 (= N89), A90 (= A90), T140 (≠ I140), S142 (= S142), Y155 (= Y155), K159 (= K159), A186 (≠ V186), V187 (≠ I187)
7v0hG Crystal structure of putative glucose 1-dehydrogenase from burkholderia cenocepacia in complex with NADP and a potential reaction product
40% identity, 98% coverage: 2:249/252 of query aligns to 8:251/253 of 7v0hG
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G12), S20 (≠ G14), K21 (≠ S15), G22 (= G16), I23 (≠ F17), A43 (≠ D36), S44 (≠ I37), S45 (≠ G38), G68 (≠ A61), D69 (= D62), V70 (= V63), N96 (= N89), S97 (≠ A90), G98 (= G91), Y100 (≠ H94), I144 (= I140), S146 (= S142), Y159 (= Y155), K163 (= K159), P189 (= P185), G190 (vs. gap), M191 (≠ V186), I192 (= I187), T194 (≠ A189), G196 (= G191), T197 (≠ L192)
- binding (2R)-2-(hydroxymethyl)pentanedioic acid: S146 (= S142), Y159 (= Y155), M191 (≠ V186), I202 (≠ M197)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
35% identity, 99% coverage: 1:249/252 of query aligns to 3:251/255 of 5itvA
- active site: G18 (= G16), S141 (= S142), Y154 (= Y155), K158 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), I39 (= I37), T61 (≠ A61), I63 (≠ V63), N89 (= N89), G91 (= G91), T139 (≠ I140), S141 (= S142), Y154 (= Y155), K158 (= K159), P184 (= P185), G185 (= G198), I186 (≠ V199), I187 (≠ P200)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 100% coverage: 1:252/252 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G16), S142 (= S142), Q152 (≠ L152), Y155 (= Y155), K159 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G12), S14 (≠ G14), R15 (≠ S15), G16 (= G16), I17 (≠ F17), N35 (≠ A35), Y36 (≠ D36), N37 (≠ I37), G38 (= G38), S39 (≠ E39), N63 (≠ D62), V64 (= V63), N90 (= N89), A91 (= A90), I93 (≠ T92), I113 (≠ V113), S142 (= S142), Y155 (= Y155), K159 (= K159), P185 (= P185), I188 (≠ L193), T190 (≠ E195)
5epoA The three-dimensional structure of clostridium absonum 7alpha- hydroxysteroid dehydrogenase (see paper)
36% identity, 98% coverage: 2:249/252 of query aligns to 2:247/261 of 5epoA
- active site: G16 (= G16), T144 (≠ S142), I152 (≠ P150), Y157 (= Y155), K161 (= K159), R193 (≠ G191)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S12 (≠ G12), T14 (≠ G14), R15 (≠ S15), G16 (= G16), I17 (≠ F17), R37 (≠ I37), F61 (≠ A61), N62 (≠ D62), N89 (= N89), Y90 (≠ A90), G91 (= G91), Y157 (= Y155), K161 (= K159), P187 (= P185), G188 (≠ V186), I190 (≠ S188), T192 (= T190), R193 (≠ G191), A194 (≠ L192), A195 (≠ L193)
- binding taurochenodeoxycholic acid: T93 (= T93), T144 (≠ S142), G146 (≠ A144), R154 (≠ L152), Y157 (= Y155), G188 (≠ V186), N198 (≠ F196), M199 (= M197), F203 (≠ N205)
G9FRD7 7alpha-hydroxysteroid dehydrogenase; 7alpha-HSDH; NADP-dependent 7alpha-hydroxysteroid dehydrogenase; EC 1.1.1.- from Clostridium sardiniense (Clostridium absonum) (see 2 papers)
36% identity, 98% coverage: 2:249/252 of query aligns to 3:248/262 of G9FRD7
- SSTRGI 13:18 (≠ GGGSGF 12:17) binding
- R38 (≠ I37) binding ; mutation to D: Loss of catalytic activity.
- NA 63:64 (≠ DV 62:63) binding
- N90 (= N89) binding
- T145 (≠ S142) binding
- Y158 (= Y155) binding ; binding
- K162 (= K159) binding
- IGTRA 191:195 (≠ SATGL 188:192) binding
Sites not aligning to the query:
- 261:262 mutation Missing: 5-fold reduction in catalytic efficiency.
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
35% identity, 100% coverage: 1:252/252 of query aligns to 1:245/248 of Q9KJF1
- M1 (= M1) modified: Initiator methionine, Removed
- S15 (= S15) binding
- D36 (= D36) binding
- D62 (= D62) binding
- I63 (≠ V63) binding
- N89 (= N89) binding
- Y153 (= Y155) binding
- K157 (= K159) binding
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
35% identity, 99% coverage: 3:252/252 of query aligns to 5:253/254 of 4fn4A
- active site: G18 (= G16), S144 (= S142), Y157 (= Y155), K161 (= K159), S202 (≠ E204)
- binding nicotinamide-adenine-dinucleotide: G14 (= G12), S17 (= S15), G18 (= G16), I19 (≠ F17), E38 (≠ D36), L39 (≠ I37), R43 (≠ G41), A63 (= A61), D64 (= D62), V65 (= V63), N91 (= N89), G93 (= G91), I94 (≠ T92), T142 (≠ I140), S144 (= S142), Y157 (= Y155), K161 (= K159), P187 (= P185), V190 (≠ L193), T192 (≠ E195), N193 (≠ F196), I194 (≠ M197)
7krmC Putative fabg bound to nadh from acinetobacter baumannii
32% identity, 100% coverage: 1:252/252 of query aligns to 1:243/244 of 7krmC
- active site: G18 (= G16), S140 (= S142), Y155 (= Y155)
- binding nicotinamide-adenine-dinucleotide: G12 (= G12), S15 (= S15), G18 (= G16), I19 (≠ F17), D38 (= D36), L39 (≠ I37), A60 (= A61), N61 (≠ D62), V62 (= V63), N88 (= N89), V111 (= V113), S140 (= S142), Y155 (= Y155), K159 (= K159), I188 (≠ L193), T190 (≠ E195)
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
35% identity, 99% coverage: 3:252/252 of query aligns to 2:244/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G12), M16 (≠ F17), D35 (= D36), I36 (= I37), I62 (≠ V63), N88 (= N89), G90 (= G91), I138 (= I140), S140 (= S142), Y152 (= Y155), K156 (= K159), I185 (≠ S188)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
33% identity, 99% coverage: 1:249/252 of query aligns to 1:240/251 of H9XP47
- N15 (≠ S15) binding
- M17 (≠ F17) binding
- D36 (= D36) binding
- D60 (= D62) binding
- V61 (= V63) binding
- N87 (= N89) binding
- S138 (= S142) binding ; binding
- V139 (≠ T143) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (≠ A144) binding
- Y151 (= Y155) binding ; binding ; binding
- K155 (= K159) binding
- V184 (≠ S188) binding
- T186 (= T190) binding
- RDK 197:199 (≠ RKK 206:208) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
3wyeA Crystal structure of chimeric engineered (2s,3s)-butanediol dehydrogenase complexed with NAD+
38% identity, 97% coverage: 6:249/252 of query aligns to 2:251/255 of 3wyeA
- active site: G12 (= G16), S138 (= S142), Y151 (= Y155), K155 (= K159), L196 (= L193)
- binding nicotinamide-adenine-dinucleotide: G8 (= G12), Q11 (≠ S15), G12 (= G16), I13 (≠ F17), D32 (= D36), Y33 (≠ I37), V57 (≠ A61), D58 (= D62), V59 (= V63), N85 (= N89), A86 (= A90), S138 (= S142), Y151 (= Y155), K155 (= K159), P181 (= P185), G182 (≠ V186), V184 (≠ S188), T186 (= T190), M188 (≠ L192), W189 (vs. gap)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
35% identity, 99% coverage: 1:249/252 of query aligns to 6:249/258 of 4wecA
- active site: G21 (= G16), S143 (= S142), Q154 (≠ L152), Y157 (= Y155), K161 (= K159)
- binding nicotinamide-adenine-dinucleotide: G17 (= G12), A19 (≠ G14), S20 (= S15), G21 (= G16), I22 (≠ F17), D41 (= D36), I42 (= I37), V61 (≠ A61), D62 (= D62), V63 (= V63), N89 (= N89), T141 (≠ I140), Y157 (= Y155), K161 (= K159), P187 (= P185), P189 (≠ I187), V190 (≠ S188)
Query Sequence
>HSERO_RS11255 FitnessBrowser__HerbieS:HSERO_RS11255
MRLQDKVAIVTGGGSGFGEGIAKAYAREGAAIVVADIGEAGGLRVVEEIKAAGGRAVFAK
ADVSKRADMDQLLATALEHFGKLDIVVNNAGTTHRNRPMLEVEEDEFDRVYAVNVKSIFL
SAKTFVPYFRQVGGGAFINIASTAGIRPRPGLTWYNGSKGAVITTSKSMAAELGPDKIRV
NCVNPVISATGLLSEFMGVPDTPENRKKFVATIPMGRFSTPEDIANACLYLGSDEAEFVT
GVCIEVDGGRCV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory