SitesBLAST
Comparing HSERO_RS11350 FitnessBrowser__HerbieS:HSERO_RS11350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07003 Pyruvate dehydrogenase [ubiquinone]; Pyruvate oxidase; POX; Pyruvate:ubiquinone-8 oxidoreductase; EC 1.2.5.1 from Escherichia coli (strain K12) (see 4 papers)
39% identity, 98% coverage: 1:555/564 of query aligns to 1:552/572 of P07003
- 1:182 (vs. 1:183, 42% identical) Pyr domain
- E50 (= E50) binding
- 183:334 (vs. 184:334, 34% identical) FAD-binding domain
- S210 (≠ N210) binding
- LR 234:235 (≠ FR 234:235) binding
- TGLI 251:254 (≠ VGLI 251:254) binding
- TQFPY 274:278 (≠ SDYPY 274:278) binding
- D292 (= D292) binding
- S297 (≠ V297) binding
- DI 311:312 (≠ SV 311:312) binding
- 335:530 (vs. 335:533, 39% identical) PP-binding domain
- T382 (≠ V384) binding
- FN 403:404 (= FN 405:406) binding
- GSM 406:408 (≠ AAV 408:410) binding
- D433 (= D435) binding
- DGG 433:435 (= DGG 435:437) binding
- N460 (= N462) binding
- 460:466 (vs. 462:468, 43% identical) binding
- V462 (≠ E464) binding
- F465 (≠ L467) Moves into active site upon enzyme activation, plays a role in electron transfer
- A533 (≠ P536) mutation to T: In poxB11; poor activity in vivo, no longer activated by lipids.
- YM 549:550 (≠ AK 552:553) In vitro cleavage to yield alpha-peptide
Sites not aligning to the query:
- 531:572 Membrane-binding domain
- 549:572 mutation Missing: In poxB6. Inactive in vivo, does not complement inactive mutants. Active in vitro, no longer activated by nor binds to, detergents.
- 553 A→V: In poxB14; poor activity in vivo, no longer activated by lipids.
- 560 D→P: In poxB15; normal activity.
- 564 E→P: In poxB16; loss of activity, weakly activated by cleavage.
- 564:572 mutation Missing: In poxB7 Inactive in vivo, reduced activity in vitro.
- 570:572 mutation Missing: In poxB8; reduced activity in vitro, not activated by lipids.
- 572 R→G: In poxB10; reduced activity in vivo and in vitro; may interact less with membranes.
3ey9A Structural basis for membrane binding and catalytic activation of the peripheral membrane enzyme pyruvate oxidase from escherichia coli (see paper)
39% identity, 99% coverage: 4:563/564 of query aligns to 3:558/571 of 3ey9A
- active site: V23 (= V24), G25 (= G26), D26 (= D27), S27 (≠ A28), L28 (= L29), E49 (= E50), S72 (≠ T73), F111 (≠ L112), Q112 (= Q113), G160 (≠ A161), L252 (= L253), A279 (≠ E280), V379 (≠ T382), G405 (≠ A408), M407 (≠ V410), D432 (= D435), N459 (= N462), V461 (≠ E464), L462 (≠ W465), F464 (≠ L467), V465 (= V468), E468 (= E471), K528 (≠ P532)
- binding flavin-adenine dinucleotide: G208 (= G209), S209 (≠ N210), G210 (= G211), A232 (≠ T233), L233 (≠ F234), R234 (= R235), T250 (≠ V251), G251 (= G252), I253 (= I254), G272 (= G273), T273 (≠ S274), Q274 (≠ D275), F275 (≠ Y276), Y277 (= Y278), D291 (= D292), I292 (≠ E293), S296 (≠ V297), G309 (= G310), D310 (≠ S311), I311 (≠ V312), T383 (= T386), F402 (= F405), N403 (= N406), Y548 (≠ A552)
- binding magnesium ion: D432 (= D435), N459 (= N462)
- binding thiamine diphosphate: T24 (≠ V25), E49 (= E50), S72 (≠ T73), G76 (= G77), H79 (= H80), G380 (= G383), T381 (≠ V384), P382 (≠ V385), M407 (≠ V410), G431 (= G434), D432 (= D435), G433 (= G436), G434 (= G437), N459 (= N462), V461 (≠ E464), L462 (≠ W465), G463 (= G466)
4feeA High-resolution structure of pyruvate oxidase in complex with reaction intermediate 2-hydroxyethyl-thiamin diphosphate carbanion-enamine, crystal b (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/586 of 4feeA
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), P238 (≠ R235), A254 (≠ V251), N255 (≠ G252), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N390 (≠ T386), N409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
- binding pyruvic acid: N255 (≠ G252), R256 (≠ L253)
- binding 2-[(2e)-3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-hydroxyethylidene)-4-methyl-2,3-dihydro-1,3-thiazol-5-yl]ethyltrihydrogen diphosphate: V386 (≠ T382), D388 (≠ V384), A412 (= A408), M414 (≠ V410), G438 (= G434), G440 (= G436), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), F471 (≠ L467), I472 (≠ V468)
Sites not aligning to the query:
1powA The refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/585 of 1powA
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), F113 (≠ L112), Q114 (= Q113), E115 (= E114), V162 (≠ A161), R256 (≠ L253), E283 (= E280), V386 (≠ T382), A412 (= A408), M414 (≠ V410), D439 (= D435), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), F471 (≠ L467), I472 (≠ V468), E475 (= E471), G538 (≠ P532)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), A254 (≠ V251), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), Y279 (= Y276), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
- binding thiamine diphosphate: D388 (≠ V384), M414 (≠ V410), G440 (= G436), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), F471 (≠ L467), I472 (≠ V468)
2ezuA Pyruvate oxidase variant f479w in complex with reaction intermediate 2-acetyl-thiamin diphosphate (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/585 of 2ezuA
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), F113 (≠ L112), Q114 (= Q113), E115 (= E114), V162 (≠ A161), R256 (≠ L253), E283 (= E280), V386 (≠ T382), A412 (= A408), M414 (≠ V410), D439 (= D435), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), W471 (≠ L467), I472 (≠ V468), E475 (= E471), G538 (≠ P532)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), P238 (≠ R235), A254 (≠ V251), N255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N409 (≠ F405)
- binding 2-acetyl-thiamine diphosphate: V386 (≠ T382), D388 (≠ V384), M414 (≠ V410), G438 (= G434), G440 (= G436), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), W471 (≠ L467), I472 (≠ V468)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
Sites not aligning to the query:
2ez9A Pyruvate oxidase variant f479w in complex with reaction intermediate analogue 2-phosphonolactyl-thiamin diphosphate (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/585 of 2ez9A
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), F113 (≠ L112), Q114 (= Q113), E115 (= E114), V162 (≠ A161), R256 (≠ L253), E283 (= E280), V386 (≠ T382), A412 (= A408), M414 (≠ V410), D439 (= D435), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), W471 (≠ L467), I472 (≠ V468), E475 (= E471), G538 (≠ P532)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), P238 (≠ R235), A254 (≠ V251), N255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-{(1s)-1-hydroxy-1-[(r)-hydroxy(methoxy)phosphoryl]ethyl}-5-(2-{[(s)-hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: V386 (≠ T382), D388 (≠ V384), M414 (≠ V410), G438 (= G434), G440 (= G436), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), W471 (≠ L467), I472 (≠ V468), E475 (= E471)
2ez8A Pyruvate oxidase variant f479w in complex with reaction intermediate 2-lactyl-thiamin diphosphate (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/585 of 2ez8A
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), F113 (≠ L112), Q114 (= Q113), E115 (= E114), V162 (≠ A161), R256 (≠ L253), E283 (= E280), V386 (≠ T382), A412 (= A408), M414 (≠ V410), D439 (= D435), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), W471 (≠ L467), I472 (≠ V468), E475 (= E471), G538 (≠ P532)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), P238 (≠ R235), A254 (≠ V251), N255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N390 (≠ T386), N409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
- binding 3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-2-(1-carboxy-1-hydroxyethyl)-5-(2-{[hydroxy(phosphonooxy)phosphoryl]oxy}ethyl)-4-methyl-1,3-thiazol-3-ium: D388 (≠ V384), M414 (≠ V410), G438 (= G434), G440 (= G436), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), W471 (≠ L467), I472 (≠ V468)
Sites not aligning to the query:
2ez4B Pyruvate oxidase variant f479w (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:539/585 of 2ez4B
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), F113 (≠ L112), Q114 (= Q113), E115 (= E114), V162 (≠ A161), R256 (≠ L253), E283 (= E280), V386 (≠ T382), A412 (= A408), M414 (≠ V410), D439 (= D435), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), W471 (≠ L467), I472 (≠ V468), E475 (= E471), G538 (≠ P532)
- binding flavin-adenine dinucleotide: H93 (= H92), G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), Y237 (≠ F234), P238 (≠ R235), A254 (≠ V251), N255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), N277 (≠ S274), N278 (≠ D275), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), K303 (≠ V297), D317 (≠ S311), A318 (≠ V312), N409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462), Q468 (≠ E464)
- binding phosphate ion: W471 (≠ L467), E475 (= E471)
- binding thiamine diphosphate: D388 (≠ V384), A412 (= A408), M414 (≠ V410), G438 (= G434), D439 (= D435), G440 (= G436), G441 (= G437), N466 (= N462), Q468 (≠ E464), Y469 (≠ W465), G470 (= G466), W471 (≠ L467), I472 (≠ V468)
2djiA Crystal structure of pyruvate oxidase from aerococcus viridans containing fad (see paper)
30% identity, 89% coverage: 17:520/564 of query aligns to 18:524/590 of 2djiA
- active site: I25 (≠ V24), S27 (≠ G26), G28 (≠ D27), T29 (≠ A28), L30 (= L29), E52 (= E50), S75 (≠ T73), F114 (≠ L112), Q115 (= Q113), G163 (≠ A161), R257 (≠ L253), E284 (= E280), V387 (≠ T382), A413 (= A408), M415 (≠ V410), D440 (= D435), N467 (= N462), E469 (= E464), Y470 (≠ W465), F472 (≠ L467), I473 (≠ V468), K476 (≠ E471)
- binding flavin-adenine dinucleotide: G213 (= G209), I214 (≠ N210), G215 (= G211), T237 (= T233), G238 (≠ F234), K239 (≠ R235), T255 (≠ V251), Y256 (≠ G252), R257 (≠ L253), V258 (≠ I254), G277 (= G273), S278 (= S274), N279 (≠ D275), F280 (≠ Y276), P281 (= P277), F282 (≠ Y278), D299 (= D292), I300 (≠ E293), M304 (≠ V297), D318 (≠ S311), A319 (≠ V312), P410 (≠ F405)
Sites not aligning to the query:
1v5gA Crystal structure of the reaction intermediate between pyruvate oxidase containing fad and tpp, and substrate pyruvate (see paper)
30% identity, 89% coverage: 17:520/564 of query aligns to 17:523/589 of 1v5gA
- binding flavin-adenine dinucleotide: G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), G237 (≠ F234), K238 (≠ R235), T254 (≠ V251), Y255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), S277 (= S274), N278 (≠ D275), F279 (≠ Y276), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), M303 (≠ V297), D317 (≠ S311), A318 (≠ V312), P409 (≠ F405)
- binding 2-acetyl-thiamine diphosphate: V386 (≠ T382), N388 (≠ V384), M414 (≠ V410), G438 (= G434), G440 (= G436), A441 (≠ G437), N466 (= N462), E468 (= E464), Y469 (≠ W465), A470 (≠ G466), F471 (≠ L467), I472 (≠ V468)
- binding magnesium ion: D439 (= D435), N466 (= N462), E468 (= E464)
1v5fA Crystal structure of pyruvate oxidase complexed with fad and tpp, from aerococcus viridans (see paper)
30% identity, 89% coverage: 17:520/564 of query aligns to 17:523/589 of 1v5fA
- binding flavin-adenine dinucleotide: G212 (= G209), I213 (≠ N210), G214 (= G211), T236 (= T233), G237 (≠ F234), K238 (≠ R235), T254 (≠ V251), Y255 (≠ G252), R256 (≠ L253), V257 (≠ I254), G276 (= G273), S277 (= S274), N278 (≠ D275), F279 (≠ Y276), P280 (= P277), F281 (≠ Y278), D298 (= D292), I299 (≠ E293), M303 (≠ V297), D317 (≠ S311), A318 (≠ V312), P409 (≠ F405)
- binding magnesium ion: D439 (= D435), N466 (= N462)
- binding thiamine diphosphate: N388 (≠ V384), S389 (≠ V385), M414 (≠ V410), G438 (= G434), G440 (= G436), N466 (= N462), Y469 (≠ W465), A470 (≠ G466), F471 (≠ L467), I472 (≠ V468)
1y9dD Pyruvate oxidase variant v265a from lactobacillus plantarum (see paper)
31% identity, 93% coverage: 9:533/564 of query aligns to 9:514/560 of 1y9dD
- active site: I24 (≠ V24), G26 (= G26), G27 (≠ D27), S28 (≠ A28), I29 (≠ L29), E51 (= E50), S74 (≠ T73), E108 (≠ L112), V155 (≠ A161), R241 (≠ L253), V361 (≠ T382), A387 (= A408), M389 (≠ V410), D414 (= D435), N441 (= N462), Q443 (≠ E464), Y444 (≠ W465), F446 (≠ L467), I447 (≠ V468), E450 (= E471), G513 (≠ P532)
- binding flavin-adenine dinucleotide: I198 (≠ N210), G199 (= G211), T221 (= T233), P223 (≠ R235), G261 (= G273), N262 (≠ S274), N263 (≠ D275), D273 (= D292), I274 (≠ E293), K278 (≠ V297), D292 (≠ S311), A293 (≠ V312)
- binding magnesium ion: D414 (= D435), N441 (= N462), Q443 (≠ E464)
- binding thiamine diphosphate: E51 (= E50), S74 (≠ T73), P77 (= P76), H81 (= H80), D363 (≠ V384), M389 (≠ V410), G413 (= G434), G415 (= G436), N441 (= N462), Q443 (≠ E464), Y444 (≠ W465), G445 (= G466), F446 (≠ L467), I447 (≠ V468)
5k3sA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, bispyribac-sodium (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/583 of 5k3sA
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding 2,6-bis[(4,6-dimethoxypyrimidin-2-yl)oxy]benzoic acid: R292 (≠ S279), M485 (≠ L467), W489 (≠ M472)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), M266 (≠ L253), G286 (= G273), R288 (≠ D275), D290 (≠ P277), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), M405 (≠ L387), G423 (≠ F405)
- binding magnesium ion: D453 (= D435), N480 (= N462), H482 (≠ E464)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), G426 (≠ A408), M428 (≠ V410), D453 (= D435), G454 (= G436), S455 (≠ G437), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
Sites not aligning to the query:
5k2oA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a pyrimidinyl-benzoate herbicide, pyrithiobac (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/585 of 5k2oA
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding 2-chloranyl-6-(4,6-dimethoxypyrimidin-2-yl)sulfanyl-benzoic acid: M266 (≠ L253), R292 (≠ S279), W489 (≠ M472)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), G286 (= G273), R288 (≠ D275), D290 (≠ P277), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), Q404 (≠ T386), M405 (≠ L387), G423 (≠ F405)
- binding magnesium ion: D453 (= D435), N480 (= N462), H482 (≠ E464)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), M428 (≠ V410), D453 (= D435), G454 (= G436), S455 (≠ G437), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
Sites not aligning to the query:
P17597 Acetolactate synthase, chloroplastic; AtALS; Acetohydroxy-acid synthase; Protein CHLORSULFURON RESISTANT 1; EC 2.2.1.6 from Arabidopsis thaliana (Mouse-ear cress) (see 8 papers)
27% identity, 96% coverage: 2:541/564 of query aligns to 96:651/670 of P17597
- A122 (= A28) mutation to V: Reduced catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- M124 (≠ N30) mutation to E: Reduced catalytic activity. Resistant to imidazolinone herbicides and reduced sensitivity to sulfonylurea herbicides.; mutation to I: No effect on catalytic activity. Increased resistance to imidazolinone herbicides.
- E144 (= E50) binding
- S186 (≠ H92) binding
- P197 (= P103) mutation to S: In csr1-1/GH50; resistant to sulfonylurea but not to imidazolinone herbicides.
- R199 (≠ A105) mutation R->A,E: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
- Q207 (= Q113) binding
- K220 (≠ A126) binding
- R246 (= R152) binding ; binding
- K256 (≠ A161) binding
- G308 (≠ N210) binding
- TL 331:332 (≠ TF 233:234) binding
- C340 (vs. gap) modified: Cysteine sulfinic acid (-SO2H)
- LGMH 349:352 (≠ VGLI 251:254) binding
- GVRFD 371:375 (≠ GSDYP 273:277) binding
- DR 376:377 (≠ YS 278:279) binding
- DI 395:396 (≠ DE 292:293) binding
- DV 414:415 (≠ SV 311:312) binding
- QH 487:488 (≠ VV 384:385) binding
- GG 508:509 (≠ FN 405:406) binding
- GAM 511:513 (≠ AAV 408:410) binding
- D538 (= D435) binding
- DGS 538:540 (≠ DGG 435:437) binding
- N565 (= N462) binding
- NQHLGM 565:570 (≠ NREWGL 462:467) binding
- H567 (≠ E464) binding
- W574 (≠ M472) binding ; mutation to L: Increased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.; mutation to S: Slightly decreased catalytic activity. Resistant to imidazolinone and sulfonylurea herbicides.
Sites not aligning to the query:
- 653 binding ; S→A: No effect on catalytic activity or sensitivity to herbicides.; S→F: No effect on catalytic activity. Resistant to imidazolinone herbicides and also slightly sulfonylurea-resistant.; S→N: In csr1-2/GH90; no effect on catalytic activity. Resistant to imidazolinone but not to sulfonylurea herbicides.; S→T: No effect on catalytic activity. Resistant to imidazolinone herbicides but not to sulfonylurea herbicides.
8et4A Crystal structure of wild-type arabidopsis thaliana acetohydroxyacid synthase in complex with amidosulfuron (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/582 of 8et4A
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), G426 (≠ A408), M428 (≠ V410), G452 (= G434), D453 (= D435), G454 (= G436), S455 (≠ G437), M458 (= M440), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), M266 (≠ L253), H267 (≠ I254), G286 (= G273), V287 (≠ S274), R288 (≠ D275), D290 (≠ P277), R292 (≠ S279), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), M405 (≠ L387), G423 (≠ F405)
- binding magnesium ion: F370 (≠ L346), D453 (= D435), M458 (= M440), Q461 (≠ G443), N480 (= N462), H482 (≠ E464), K533 (≠ P507)
- binding N-{[(4,6-dimethoxypyrimidin-2-yl)carbamoyl]sulfamoyl}-N-methylmethanesulfonamide: M266 (≠ L253), R292 (≠ S279), M485 (≠ L467), W489 (≠ M472)
Sites not aligning to the query:
5wj1A Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a triazolopyrimidine herbicide, penoxsulam (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/582 of 5wj1A
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), M263 (≠ G250), L264 (≠ V251), G286 (= G273), R288 (≠ D275), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), M405 (≠ L387), G423 (≠ F405), G424 (≠ N406)
- binding magnesium ion: D453 (= D435), N480 (= N462), H482 (≠ E464)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M266 (≠ L253), D291 (≠ Y278), R292 (≠ S279), M485 (≠ L467), W489 (≠ M472)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), M428 (≠ V410), D453 (= D435), G454 (= G436), S455 (≠ G437), M458 (= M440), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
Sites not aligning to the query:
5k6tA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, propoxycarbazone-sodium (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/582 of 5k6tA
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: H267 (≠ I254), R292 (≠ S279), M485 (≠ L467), W489 (≠ M472)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), G286 (= G273), R288 (≠ D275), D290 (≠ P277), R292 (≠ S279), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), Q404 (≠ T386), M405 (≠ L387), G423 (≠ F405)
- binding magnesium ion: D453 (= D435), N480 (= N462), H482 (≠ E464)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), G426 (≠ A408), M428 (≠ V410), G452 (= G434), G454 (= G436), S455 (≠ G437), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466)
Sites not aligning to the query:
5k6rA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with a sulfonylamino-carbonyl-triazolinone herbicide, thiencarbazone-methyl (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/582 of 5k6rA
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding methyl 4-[(3-methoxy-4-methyl-5-oxidanylidene-1,2,4-triazol-1-yl)carbonylsulfamoyl]-5-methyl-thiophene-3-carboxylate: R292 (≠ S279), W489 (≠ M472)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G223 (≠ N210), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), M266 (≠ L253), G286 (= G273), R288 (≠ D275), R292 (≠ S279), V293 (vs. gap), D310 (= D292), I311 (≠ E293), G328 (= G310), D329 (≠ S311), V330 (= V312), M405 (≠ L387), G423 (≠ F405)
- binding magnesium ion: D453 (= D435), N480 (= N462), H482 (≠ E464)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), G426 (≠ A408), M428 (≠ V410), D453 (= D435), G454 (= G436), S455 (≠ G437), M458 (= M440), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
Sites not aligning to the query:
1z8nA Crystal structure of arabidopsis thaliana acetohydroxyacid synthase in complex with an imidazolinone herbicide, imazaquin (see paper)
27% identity, 96% coverage: 2:541/564 of query aligns to 11:566/582 of 1z8nA
- active site: Y33 (≠ V24), G35 (= G26), G36 (≠ D27), A37 (= A28), S38 (≠ L29), E59 (= E50), T82 (= T73), F121 (≠ L112), Q122 (= Q113), E123 (= E114), K171 (≠ A161), M266 (≠ L253), V293 (vs. gap), V400 (≠ T382), G426 (≠ A408), M428 (≠ V410), D453 (= D435), N480 (= N462), H482 (≠ E464), L483 (≠ W465), M485 (≠ L467), V486 (= V468), W489 (≠ M472), H558 (≠ D533)
- binding 2-(4-isopropyl-4-methyl-5-oxo-4,5-dihydro-1h-imidazol-2-yl)quinoline-3-carboxylic acid: K135 (≠ A126), R161 (= R152), Y191 (≠ L178), R194 (= R181), D291 (≠ Y278), R292 (≠ S279), D312 (≠ R294), W489 (≠ M472)
- binding flavin-adenine dinucleotide: R161 (= R152), G222 (= G209), G224 (= G211), T246 (= T233), L247 (≠ F234), M248 (≠ R235), L264 (≠ V251), G265 (= G252), M266 (≠ L253), H267 (≠ I254), G286 (= G273), V287 (≠ S274), R288 (≠ D275), D290 (≠ P277), R292 (≠ S279), V293 (vs. gap), D310 (= D292), I311 (≠ E293), D329 (≠ S311), V330 (= V312), M405 (≠ L387), G423 (≠ F405), G424 (≠ N406)
- binding magnesium ion: D453 (= D435), N480 (= N462)
- binding thiamine diphosphate: V400 (≠ T382), G401 (= G383), Q402 (≠ V384), H403 (≠ V385), G426 (≠ A408), M428 (≠ V410), G452 (= G434), G454 (= G436), S455 (≠ G437), N480 (= N462), H482 (≠ E464), L483 (≠ W465), G484 (= G466), M485 (≠ L467), V486 (= V468)
Sites not aligning to the query:
Query Sequence
>HSERO_RS11350 FitnessBrowser__HerbieS:HSERO_RS11350
MPATVADILIDTLYEIGVRQIFGVVGDALNPLTDAIRRDKRIEWIGVRHEEGAALAAAGQ
AKLTGRLAVCCGTTGPGANHLVAGLYEARKDHAPVLAISGGVPAAHRGTDYLQENSPELL
FRDVAAYSQIITSPDQAPAVFHQAIAQAYAQRGVAHLNIPADVIGAKTSGSVPSLHTLRE
RTPLSPPAADIQAAADLINAAGSVAIFAGNGCRGAIDEVLALASKLQAPVMHTFRGKDLA
SYDHPHWIGGVGLIGGAPGTDALHAAEVMLMLGSDYPYSEFLPTKSKVIQIDERGFVLGR
RAPVTLGITGSVAPAVQQLLERVEGKTDGAFLQQANAHRERWNAKLDSAAEIKRHHKKIK
PQSVARAISDLADDDAAFVVDTGVVTLWCGNWIRQRGGQRILASFNNAAVGTSLGQANGI
QALDRERQVVVAVGDGGFTMLLGEFMTSVEHRLPVKVVVFNNREWGLVHLEMEEAGMPAF
EGSEFPNPDFAAFARACGGQGFSVRTPEELEGGLQQLLAAPGPAVLDVFIDPDELPVMPH
IKMEQIWRFGLAKVRESLIAMKGG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory