Comparing HSERO_RS11440 FitnessBrowser__HerbieS:HSERO_RS11440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
41% identity, 89% coverage: 26:249/251 of query aligns to 1:225/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
41% identity, 89% coverage: 26:248/251 of query aligns to 1:226/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
42% identity, 86% coverage: 32:247/251 of query aligns to 12:228/229 of 5t0wA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
39% identity, 86% coverage: 34:249/251 of query aligns to 14:229/229 of 6svfA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
37% identity, 86% coverage: 34:248/251 of query aligns to 7:222/226 of 8eyzA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
34% identity, 93% coverage: 14:247/251 of query aligns to 7:253/260 of P02911
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 87% coverage: 32:250/251 of query aligns to 3:223/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 87% coverage: 32:249/251 of query aligns to 13:232/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
35% identity, 87% coverage: 32:250/251 of query aligns to 7:227/235 of 2pvuA
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
34% identity, 87% coverage: 30:247/251 of query aligns to 1:228/235 of 5owfA
1lstA Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand (see paper)
34% identity, 87% coverage: 30:247/251 of query aligns to 4:231/238 of 1lstA
1lahE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 87% coverage: 30:247/251 of query aligns to 4:231/238 of 1lahE
1lagE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 87% coverage: 30:247/251 of query aligns to 4:231/238 of 1lagE
1lafE Structural bases for multiple ligand specificity of the periplasmic lysine-, arginine-, ornithine-binding protein (see paper)
34% identity, 87% coverage: 30:247/251 of query aligns to 4:231/238 of 1lafE
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
35% identity, 86% coverage: 31:247/251 of query aligns to 2:222/224 of 4ymxA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
34% identity, 87% coverage: 29:246/251 of query aligns to 13:233/235 of 4g4pA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
34% identity, 87% coverage: 32:249/251 of query aligns to 19:236/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
34% identity, 87% coverage: 32:249/251 of query aligns to 19:236/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
34% identity, 87% coverage: 32:249/251 of query aligns to 19:236/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
34% identity, 87% coverage: 32:249/251 of query aligns to 15:232/237 of 3vv5A
>HSERO_RS11440 FitnessBrowser__HerbieS:HSERO_RS11440
MKTFSKLLCAGMASLSLLIAAVPAAHANGEVIRVGTDATFPPMEFVKDGKRTGFDVELIE
ALAKTMGKKVQWIDIDFKGLIPGLVSNRFDIAASAIYMTDERRKVVNFSDPYYRGGLAVL
VRRDDNSIKVPEDLNKGKRVSVQVGTKSVGYLKDNFPGVERVEVEKNQAMFDLLATGRVN
AVVTGRPAAVEYARTQPLVRVLDKGLTTELYGFALRKSDTELTAQLNKALQTLRMNGTYT
ALTDKWFGKSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory