Comparing HSERO_RS11455 FitnessBrowser__HerbieS:HSERO_RS11455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
51% identity, 100% coverage: 1:456/458 of query aligns to 4:452/453 of Q9HU77
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
51% identity, 100% coverage: 1:456/458 of query aligns to 3:451/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
51% identity, 99% coverage: 1:455/458 of query aligns to 3:450/450 of 3mduA
4f0lB Crystal structure of amidohydrolase from brucella melitensis
48% identity, 98% coverage: 6:456/458 of query aligns to 10:448/449 of 4f0lB
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
22% identity, 94% coverage: 7:437/458 of query aligns to 7:398/420 of Q58936
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
23% identity, 86% coverage: 45:437/458 of query aligns to 59:418/441 of 3lnpA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
24% identity, 85% coverage: 45:433/458 of query aligns to 58:397/436 of 4f0rA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
24% identity, 85% coverage: 45:433/458 of query aligns to 58:397/434 of 4f0sA
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
28% identity, 56% coverage: 188:445/458 of query aligns to 176:421/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
28% identity, 56% coverage: 188:445/458 of query aligns to 176:421/437 of 4dykA
Sites not aligning to the query:
8is4A Structure of an isocytosine specific deaminase vcz in complexed with 5-fu (see paper)
24% identity, 86% coverage: 45:436/458 of query aligns to 58:426/452 of 8is4A
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
25% identity, 84% coverage: 45:430/458 of query aligns to 62:409/439 of 4dzhA
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
21% identity, 86% coverage: 45:437/458 of query aligns to 58:436/474 of 4v1xE
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
21% identity, 86% coverage: 45:437/458 of query aligns to 58:436/474 of P72156
Q9EYU0 Melamine deaminase; EC 3.5.4.45 from Paracidovorax citrulli (Acidovorax citrulli) (see paper)
23% identity, 45% coverage: 234:437/458 of query aligns to 242:436/474 of Q9EYU0
Sites not aligning to the query:
6ohbA E. Coli guanine deaminase (see paper)
23% identity, 57% coverage: 176:434/458 of query aligns to 170:433/435 of 6ohbA
Sites not aligning to the query:
2plmA Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine (see paper)
22% identity, 81% coverage: 24:396/458 of query aligns to 26:346/404 of 2plmA
1p1mA Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
22% identity, 81% coverage: 24:396/458 of query aligns to 26:346/404 of 1p1mA
3hpaA Crystal structure of an amidohydrolase gi:44264246 from an evironmental sample of sargasso sea (see paper)
23% identity, 90% coverage: 31:442/458 of query aligns to 43:408/428 of 3hpaA
>HSERO_RS11455 FitnessBrowser__HerbieS:HSERO_RS11455
LFCPLALLPQGWRSDVLLRWDGAGRLTHVTPDSARGSAALASGPVLPGMPNLHSHAFQRA
MAGLAETMGSPADSFWSWRELMYRFAQRLQPRQLEAIARQTYIEMLKAGYTSVCEFHYLH
HAPDGAPYADPAEMAWPLLQAAGQSGIGMTLLPVLYQQGGLGGRPVSAEQRRFVAAPSWL
LGLRERLLQHMPENDMRRYGVAPHSLRAVAPTGLEELLSGLAGQPGGSDAPIHIHVAEQL
REVEDCLAWSGQRPVQWLLSSQPVDARWCLVHATHMDDEEYRAVAGSGAVVGLCPTTEAN
LGDGVIDAPRLIDSAARWGIGSDSNIAISLRAELRLLEYAQRLHHRRRNVLAVIDAPAVA
DRLFCQALAGGAQAAGRAVAGLMPGQRADLVVLDPDHVNLAQRSSTQLLSALVFCEHDGP
MIGDVYVGGRQVVKEGRHALDDRAREDYRHALAALLKD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory