SitesBLAST
Comparing HSERO_RS11485 FitnessBrowser__HerbieS:HSERO_RS11485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
39% identity, 94% coverage: 13:501/522 of query aligns to 4:491/501 of P04983
- K43 (= K51) mutation to R: Loss of transport.
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 43% coverage: 4:227/522 of query aligns to 8:226/378 of P69874
- C26 (≠ R22) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y23) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ V40) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ A49) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ S55) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (= L71) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ G139) mutation to M: Loss of ATPase activity and transport.
- D172 (= D174) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 42% coverage: 11:230/522 of query aligns to 2:224/648 of P75831
- K47 (= K51) mutation to L: Lack of activity.
- D169 (= D174) mutation to N: Lack of activity.
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 39% coverage: 27:230/522 of query aligns to 22:223/615 of 5lilA
- binding adenosine-5'-triphosphate: V22 (= V27), S42 (≠ N47), G43 (= G48), G45 (= G50), K46 (= K51), S47 (= S52), T48 (= T53), Q92 (= Q94), K136 (≠ P143), Q143 (≠ D149), S145 (≠ G151), G147 (= G153), Q148 (≠ H154)
- binding magnesium ion: S47 (= S52), Q92 (= Q94)
Sites not aligning to the query:
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 39% coverage: 27:230/522 of query aligns to 22:223/592 of 5lj7A
- binding adenosine-5'-triphosphate: V22 (= V27), S42 (≠ N47), G43 (= G48), G45 (= G50), K46 (= K51), S47 (= S52), T48 (= T53), Q92 (= Q94), K136 (≠ P143), Q143 (≠ D149), S145 (≠ G151), G147 (= G153), Q148 (≠ H154)
- binding magnesium ion: S47 (= S52), Q92 (= Q94)
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 42% coverage: 12:228/522 of query aligns to 1:215/241 of 4u00A
7arlD Lolcde in complex with lipoprotein and adp (see paper)
30% identity, 42% coverage: 13:229/522 of query aligns to 2:222/222 of 7arlD
7mdyC Lolcde nucleotide-bound
30% identity, 42% coverage: 13:229/522 of query aligns to 2:222/226 of 7mdyC
- binding adp orthovanadate: Y12 (= Y23), G42 (= G48), S43 (≠ A49), G44 (= G50), K45 (= K51), S46 (= S52), T47 (= T53), Q91 (= Q94), H138 (≠ W144), E142 (≠ D149), S144 (≠ G151), G145 (≠ L152), G146 (= G153), E168 (= E175), N172 (≠ M179), H201 (= H207)
- binding magnesium ion: S46 (= S52), Q91 (= Q94)
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
30% identity, 42% coverage: 13:229/522 of query aligns to 5:225/233 of P75957
- G42 (= G45) mutation to D: Loss of lipoprotein release when overexpressed.
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
29% identity, 42% coverage: 13:229/522 of query aligns to 4:224/229 of 7v8iD
- binding phosphoaminophosphonic acid-adenylate ester: V23 (= V27), S43 (≠ N47), G44 (= G48), G46 (= G50), K47 (= K51), S48 (= S52), T49 (= T53), Q93 (= Q94), R137 (≠ L141), H140 (≠ W144), E144 (≠ D149), S146 (≠ G151), G148 (= G153), E149 (≠ H154), H203 (= H207)
- binding magnesium ion: S48 (= S52), Q93 (= Q94)
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 41% coverage: 13:228/522 of query aligns to 1:215/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y23), V16 (= V27), S36 (≠ N47), G37 (= G48), S38 (≠ A49), G39 (= G50), K40 (= K51), S41 (= S52), T42 (= T53), E162 (= E175), H194 (= H207)
- binding magnesium ion: S41 (= S52), E162 (= E175)
6fn1A Zosuquidar and uic2 fab complex of human-mouse chimeric abcb1 (abcb1hm) (see paper)
35% identity, 39% coverage: 22:227/522 of query aligns to 953:1157/1182 of 6fn1A
Sites not aligning to the query:
- binding Zosuquidar: 34, 201, 202, 272, 308, 312, 781, 785, 855, 856, 892, 893, 896, 897
7zkaA Abcb1 v978c mutant (mabcb1) in the outward facing state bound to aac
32% identity, 39% coverage: 22:227/522 of query aligns to 949:1153/1177 of 7zkaA
- binding adenosine-5'-triphosphate: R949 (= R22), S974 (≠ N47), G975 (= G48), G977 (= G50), K978 (= K51), S979 (= S52), T980 (= T53), Q1020 (vs. gap), F1059 (≠ E134), Q1077 (vs. gap), L1078 (vs. gap), S1079 (vs. gap), G1081 (= G153), Q1082 (≠ H154)
- binding magnesium ion: S979 (= S52), Q1020 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 364, 366, 372, 392, 393, 395, 396, 397, 398, 438, 493, 495, 497, 498, 946, 948
- binding (4~{S},11~{S},18~{S})-4,11-dimethyl-18-(sulfanylmethyl)-6,13,20-trithia-3,10,17,22,23,24-hexazatetracyclo[17.2.1.1^{5,8}.1^{12,15}]tetracosa-1(21),5(24),7,12(23),14,19(22)-hexaene-2,9,16-trione: 31, 35, 38, 81, 299, 303, 884
- binding Lauryl Maltose Neopentyl Glycol: 89, 93, 842
- binding magnesium ion: 397, 438
- binding cholesterol hemisuccinate: 3, 6, 17, 153, 156, 160, 163, 189, 189, 190, 193, 196, 197, 197, 200, 308, 318, 318, 322
7zk6A Abcb1 l335c mutant (mabcb1) in the outward facing state bound to 2 molecules of aac
32% identity, 39% coverage: 22:227/522 of query aligns to 949:1153/1177 of 7zk6A
- binding adenosine-5'-triphosphate: R949 (= R22), S974 (≠ N47), G975 (= G48), G977 (= G50), K978 (= K51), S979 (= S52), T980 (= T53), Q1020 (vs. gap), Q1077 (vs. gap), S1079 (vs. gap), G1080 (vs. gap), G1081 (= G153), Q1082 (≠ H154), H1134 (= H207)
- binding magnesium ion: S979 (= S52), Q1020 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 364, 366, 367, 372, 393, 395, 396, 397, 398, 438, 495, 497, 498, 946, 948
- binding (4~{S},11~{S},18~{S})-4,11-dimethyl-18-(sulfanylmethyl)-6,13,20-trithia-3,10,17,22,23,24-hexazatetracyclo[17.2.1.1^{5,8}.1^{12,15}]tetracosa-1(21),5(24),7,12(23),14,19(22)-hexaene-2,9,16-trione: 266, 270, 273, 302, 306, 310, 627, 630
- binding (4S,11S,18S)-4-[[(2,4-dinitrophenyl)disulfanyl]methyl]-11,18-dimethyl-6,13,20-trithia-3,10,17,22,23,24-hexazatetracyclo[17.2.1.1^{5,8}.1^{12,15}]tetracosa-1(21),5(24),7,12(23),14,19(22)-hexaene-2,9,16-trione: 38, 273, 299, 310, 630, 631, 634, 851, 855, 881, 885
- binding magnesium ion: 397, 438
- binding cholesterol hemisuccinate: 16, 93, 98, 834, 838
7zk5A Abcb1 l335c mutant (mabcb1) in the outward facing state bound to aac
32% identity, 39% coverage: 22:227/522 of query aligns to 949:1153/1177 of 7zk5A
- binding adenosine-5'-triphosphate: R949 (= R22), S974 (≠ N47), G975 (= G48), G977 (= G50), K978 (= K51), S979 (= S52), T980 (= T53), Q1020 (vs. gap), Q1077 (vs. gap), L1078 (vs. gap), S1079 (vs. gap), G1081 (= G153), Q1082 (≠ H154), H1134 (= H207)
- binding magnesium ion: S979 (= S52), Q1020 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 364, 366, 367, 372, 392, 393, 395, 396, 397, 398, 438, 493, 495, 496, 497, 498, 550, 946, 948
- binding (4~{S},11~{S},18~{S})-4,11-dimethyl-18-(sulfanylmethyl)-6,13,20-trithia-3,10,17,22,23,24-hexazatetracyclo[17.2.1.1^{5,8}.1^{12,15}]tetracosa-1(21),5(24),7,12(23),14,19(22)-hexaene-2,9,16-trione: 31, 45, 299, 302, 303, 306, 630, 881, 884, 885, 888
- binding magnesium ion: 397, 438
- binding cholesterol hemisuccinate: 3, 6, 7, 14, 17, 79, 98, 156, 164, 185, 186, 189, 193, 194, 197, 318, 830, 834, 838, 850, 853, 860
7zk4A The abcb1 l335c mutant (mabcb1) in the outward facing state
32% identity, 39% coverage: 22:227/522 of query aligns to 950:1154/1176 of 7zk4A
- binding adenosine-5'-triphosphate: R950 (= R22), S975 (≠ N47), G976 (= G48), G978 (= G50), K979 (= K51), S980 (= S52), T981 (= T53), Q1021 (vs. gap), Q1078 (vs. gap), L1079 (vs. gap), S1080 (vs. gap), G1081 (vs. gap), G1082 (= G153), Q1083 (≠ H154), H1135 (= H207)
- binding magnesium ion: S980 (= S52), Q1021 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 364, 367, 372, 392, 393, 395, 396, 397, 398, 438, 493, 495, 496, 497, 498, 947, 949
- binding magnesium ion: 397, 438
- binding cholesterol hemisuccinate: 6, 7, 14, 15, 16, 16, 17, 71, 75, 79, 82, 98, 101, 156, 318, 831, 839, 854, 861, 861
3d31A Modbc from methanosarcina acetivorans (see paper)
28% identity, 41% coverage: 13:228/522 of query aligns to 1:207/348 of 3d31A
Sites not aligning to the query:
7niwA Nanodisc reconstituted human abcb4 in complex with 4b1-fab (posaconazole-bound, inward-open conformation) (see paper)
32% identity, 39% coverage: 22:227/522 of query aligns to 935:1139/1140 of 7niwA
Sites not aligning to the query:
- binding cholesterol: 70, 152, 160, 266, 641, 645, 648, 839
- binding 1,2-dilinoleoyl-sn-glycero-3-phosphocholine: 173, 183, 250, 254, 257, 261, 286, 294, 298, 617, 882
- binding posaconazole: 250, 291, 294, 658, 661, 726, 841, 871, 874, 878, 882
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 43% coverage: 13:234/522 of query aligns to 1:226/343 of P30750
- 40:46 (vs. 47:53, 86% identical) binding
- E166 (= E175) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
6s7pA Nucleotide bound abcb4 (see paper)
32% identity, 39% coverage: 22:227/522 of query aligns to 923:1127/1128 of 6s7pA
- binding adenosine-5'-triphosphate: R923 (= R22), S948 (≠ N47), G949 (= G48), G951 (= G50), K952 (= K51), S953 (= S52), T954 (= T53), Q994 (vs. gap), F1033 (≠ L138), S1053 (vs. gap), G1054 (vs. gap), Q1056 (≠ H154)
- binding magnesium ion: S953 (= S52), Q994 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 342, 344, 345, 371, 373, 374, 375, 416, 471, 473, 475, 476, 920, 922
- binding cholesterol: 25, 32, 35, 65, 824, 834, 834, 838
Query Sequence
>HSERO_RS11485 FitnessBrowser__HerbieS:HSERO_RS11485
MQPNDSLSQGSPLLTLSGIGKRYAAPVLDGIDLDLRPGQVLALTGENGAGKSTLSKIICG
LVDASAGGMMLDGQPYAPASRTQAEGLGIRMVMQELNLIPTLSIAENLFLEKLPRRFGWI
DRKKLAEAARAQMEVVGLGELDPWTPVGDLGLGHQQMVEIARNLIGSCRCLILDEPTAML
TNREVELLFSRIERLRAEGVAIIYISHRLEELKRIADRIVVLRDGKLVCNDDIGRYSTEQ
LVQLMAGELTKVDLDAEHRRIGAPVLRIRGLGRAPVVHPASLALHAGEVLGIAGLIGSGR
TELLRLIFGADRAEQGEIFIGDSQEPARIRSPKDAVKAGIAMVTEDRKGQGLLLPQAISV
NTSLANLGSVSRGGMLDHAAESSVAQDYVKKLRIRSGSVAQAAGELSGGNQQKVVIARWL
YRDCPIMLFDEPTRGIDIGAKSDIYRLFAELAAQGKGLLVVSSDLRELMQICDRIAVMSA
GRIADTFSRDDWSQERILAAAFSGYVGRQEAAAAAHVAGNTA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory