SitesBLAST
Comparing HSERO_RS11500 FitnessBrowser__HerbieS:HSERO_RS11500 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8cqxA Ribokinase from t.Sp mutant a92g
45% identity, 99% coverage: 1:297/299 of query aligns to 1:294/300 of 8cqxA
- binding adenosine-5'-diphosphate: N179 (= N185), T217 (= T218), G219 (= G220), A220 (≠ E221), G222 (= G223), F250 (= F253), N272 (≠ Q275), G275 (≠ A278), A276 (= A279), T279 (≠ V282)
- binding magnesium ion: D242 (= D245), T244 (= T247), A278 (≠ S281), S287 (= S290)
4xckA Vibrio cholerae o395 ribokinase complexed with adp, ribose and cesium ion. (see paper)
46% identity, 99% coverage: 2:297/299 of query aligns to 4:298/306 of 4xckA
- active site: A249 (= A248), A250 (= A249), G251 (= G250), D252 (= D251)
- binding adenosine-5'-diphosphate: T220 (= T218), G222 (= G220), S223 (≠ E221), V242 (= V241), T247 (= T246), A250 (= A249), F254 (= F253), H276 (≠ Q275), A279 (= A278), V283 (= V282)
- binding alpha-D-ribofuranose: N11 (= N9), D13 (= D11), G39 (= G37), K40 (= K38), N43 (= N41), A95 (= A96), I107 (= I108), I109 (= I110), E140 (= E141), T248 (= T247), D252 (= D251)
1rk2A E. Coli ribokinase complexed with ribose and adp, solved in space group p212121 (see paper)
43% identity, 99% coverage: 2:297/299 of query aligns to 4:298/305 of 1rk2A
- active site: A249 (= A248), A250 (= A249), G251 (= G250), D252 (= D251)
- binding adenosine-5'-diphosphate: T220 (= T218), G222 (= G220), S223 (≠ E221), A250 (= A249), G251 (= G250), H276 (≠ Q275), A279 (= A278)
- binding tetrafluoroaluminate ion: G213 (= G211), R215 (= R213)
- binding magnesium ion: D246 (= D245), A282 (≠ S281), R285 (= R284), S291 (= S290)
- binding alpha-D-ribofuranose: N11 (= N9), D13 (= D11), G38 (= G36), G39 (= G37), K40 (= K38), N43 (= N41), E140 (= E141), D252 (= D251)
1gqtB Activation of ribokinase by monovalent cations (see paper)
43% identity, 99% coverage: 2:297/299 of query aligns to 6:300/307 of 1gqtB
- active site: A251 (= A248), A252 (= A249), G253 (= G250), D254 (= D251)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T218), G224 (= G220), S225 (≠ E221), A252 (= A249), G253 (= G250), H278 (≠ Q275), A281 (= A278)
- binding cesium ion: D248 (= D245), I250 (≠ T247), A284 (≠ S281), R287 (= R284), S293 (= S290)
- binding alpha-D-ribofuranose: N13 (= N9), D15 (= D11), G41 (= G37), N45 (= N41), E142 (= E141), D254 (= D251)
P0A9J6 Ribokinase; RK; EC 2.7.1.15 from Escherichia coli (strain K12) (see 3 papers)
43% identity, 99% coverage: 2:297/299 of query aligns to 7:301/309 of P0A9J6
6znxC Ribokinase from thermus species
42% identity, 99% coverage: 1:297/299 of query aligns to 1:259/265 of 6znxC
6a8cA Ribokinase from leishmania donovani with adp (see paper)
35% identity, 99% coverage: 2:297/299 of query aligns to 16:322/327 of 6a8cA
- binding adenosine-5'-diphosphate: G245 (= G220), A246 (≠ E221), T271 (= T246), A274 (= A249), G275 (= G250), N300 (≠ Q275), A303 (= A278)
- binding glycerol: D25 (= D11), S42 (≠ G28), S44 (≠ R30), G50 (= G36), G51 (= G37), N55 (= N41)
6a8bA Ribokinase from leishmania donovani with amppcp (see paper)
35% identity, 99% coverage: 2:297/299 of query aligns to 16:322/327 of 6a8bA
- binding phosphomethylphosphonic acid adenylate ester: G245 (= G220), A246 (≠ E221), T271 (= T246), A274 (= A249), G275 (= G250), N300 (≠ Q275), A303 (= A278), V307 (= V282)
- binding glycerol: D25 (= D11), G50 (= G36), G51 (= G37), N55 (= N41), N157 (≠ L140), I159 (≠ V142), E190 (vs. gap)
6a8aA Ribokinase from leishmania donovani with atp (see paper)
35% identity, 99% coverage: 2:297/299 of query aligns to 16:322/327 of 6a8aA
- binding adenosine-5'-triphosphate: N207 (= N185), T243 (= T218), G245 (= G220), A246 (≠ E221), G248 (= G223), T271 (= T246), G273 (≠ A248), A274 (= A249), G275 (= G250), N300 (≠ Q275), A303 (= A278), V307 (= V282)
- binding glycerol: D25 (= D11), G50 (= G36), G51 (= G37), N55 (= N41)
6wjzA Crystal structure of human ribokinase in complex with ampcp
36% identity, 100% coverage: 2:299/299 of query aligns to 5:306/315 of 6wjzA
- binding phosphomethylphosphonic acid adenosyl ester: N186 (= N185), T222 (= T218), G224 (= G220), A225 (≠ E221), G227 (= G223), T243 (≠ A238), V246 (= V241), A254 (= A249), G255 (= G250), N282 (≠ Q275), A285 (= A278), A286 (= A279), V289 (= V282)
5c3yA Structure of human ribokinase crystallized with amppnp
36% identity, 100% coverage: 2:299/299 of query aligns to 4:305/306 of 5c3yA
- active site: G252 (≠ A248), A253 (= A249), G254 (= G250), D255 (= D251)
- binding amp phosphoramidate: T221 (= T218), G223 (= G220), V245 (= V241), T250 (= T246), G254 (= G250), N281 (≠ Q275), A284 (= A278), A285 (= A279)
2fv7A Crystal structure of human ribokinase
36% identity, 100% coverage: 2:299/299 of query aligns to 4:305/308 of 2fv7A
- active site: G252 (≠ A248), A253 (= A249), G254 (= G250), D255 (= D251)
- binding adenosine-5'-diphosphate: N185 (= N185), T221 (= T218), G223 (= G220), G226 (= G223), T242 (≠ A238), V245 (= V241), A253 (= A249), G254 (= G250), N281 (≠ Q275), A284 (= A278), A285 (= A279), V288 (= V282)
6wk0B Crystal structure of human ribokinase in complex with amppcp and ribose
36% identity, 100% coverage: 2:299/299 of query aligns to 5:306/311 of 6wk0B
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T218), G224 (= G220), A225 (≠ E221), G227 (= G223), T243 (≠ A238), V246 (= V241), A254 (= A249), G255 (= G250), N282 (≠ Q275), A285 (= A278), A286 (= A279), V289 (= V282)
- binding alpha-D-ribofuranose: D14 (= D11), G40 (= G37), K41 (= K38), N44 (= N41), A96 (= A96), E141 (= E141), D256 (= D251)
5c41A Crystal structure of human ribokinase in complex with amppcp in p21 spacegroup and with 4 protomers
36% identity, 100% coverage: 2:299/299 of query aligns to 5:306/317 of 5c41A
- active site: G253 (≠ A248), A254 (= A249), G255 (= G250), D256 (= D251)
- binding phosphomethylphosphonic acid adenylate ester: N186 (= N185), T222 (= T218), G224 (= G220), A225 (≠ E221), G227 (= G223), V246 (= V241), G255 (= G250), N282 (≠ Q275), A285 (= A278), A286 (= A279)
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
36% identity, 99% coverage: 2:298/299 of query aligns to 5:306/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (= N185), K225 (≠ T218), G227 (= G220), I246 (≠ L236), A248 (= A238), A257 (= A249), G258 (= G250), F261 (= F253), A286 (= A278), S287 (≠ A279)
- binding alpha-D-ribofuranose: N12 (= N9), D14 (= D11), G40 (= G37), K41 (= K38), N44 (= N41), E144 (= E141), D259 (= D251)
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
36% identity, 99% coverage: 2:298/299 of query aligns to 71:372/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
5byfA Crystal structure of human ribokinase in complex with amp
36% identity, 98% coverage: 6:299/299 of query aligns to 10:307/313 of 5byfA
Q9H477 Ribokinase; RK; EC 2.7.1.15 from Homo sapiens (Human)
36% identity, 98% coverage: 6:299/299 of query aligns to 22:319/322 of Q9H477
6xk2A Crystal structure of ribokinase from cryptococcus neoformans var. Grubii serotype a in complex with adp
30% identity, 99% coverage: 3:297/299 of query aligns to 7:316/320 of 6xk2A
3go6B Crystal structure of m. Tuberculosis ribokinase (rv2436) in complex with ribose and amp-pnp
36% identity, 85% coverage: 2:255/299 of query aligns to 4:234/287 of 3go6B
- active site: G227 (≠ A248), A228 (= A249), G229 (= G250), D230 (= D251)
- binding adenosine-5'-diphosphate: G200 (= G220), V201 (≠ E221), G203 (= G223), V220 (= V241), T225 (= T246), A228 (= A249), G229 (= G250)
- binding magnesium ion: D224 (= D245), A226 (≠ T247)
Sites not aligning to the query:
Query Sequence
>HSERO_RS11500 FitnessBrowser__HerbieS:HSERO_RS11500
MIVIIGSVNMDLVLRVPRMPLPGETLAGDRFMTIPGGKGANQAVACARLAAPGTRVAMVA
CVGDDAFGGQMRQSITACGIDDRYIDEVAGEATGIASIMVDANAQNSIVIAAGANGRLDV
ERIERARALIEQASIVLLQLEVPMATVIHSIELAHALGKTVVLNPAPAQALPRALLQKID
YLILNEIEAAMLAEEQSEDIPMLARKLHDLGARNVVVTLGEKGVYGSFADGQQRHLPARK
VQAVDTTAAGDTFIGGFIGAIAQGRDQFEAIAYAQAAAALSVTRVGAQTSIPTRDEVVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory