Comparing HSERO_RS11580 FitnessBrowser__HerbieS:HSERO_RS11580 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yslA Crystal structure of sdoa from pseudomonas putida in complex with glutathione (see paper)
68% identity, 100% coverage: 2:291/291 of query aligns to 5:294/294 of 4yslA
4yskA Crystal structure of apo-form sdoa from pseudomonas putida (see paper)
68% identity, 100% coverage: 2:291/291 of query aligns to 5:294/294 of 4yskA
4efzA Crystal structure of a hypothetical metallo-beta-lactamase from burkholderia pseudomallei
70% identity, 99% coverage: 3:291/291 of query aligns to 4:295/295 of 4efzA
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
31% identity, 91% coverage: 10:275/291 of query aligns to 10:235/350 of 5ve5A
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
32% identity, 92% coverage: 10:276/291 of query aligns to 29:254/254 of O95571
Sites not aligning to the query:
4chlB Human ethylmalonic encephalopathy protein 1 (hethe1) (see paper)
32% identity, 91% coverage: 10:275/291 of query aligns to 13:236/237 of 4chlB
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
32% identity, 90% coverage: 10:271/291 of query aligns to 7:224/225 of 4ysbA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 92% coverage: 3:271/291 of query aligns to 51:285/294 of Q9C8L4
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
29% identity, 92% coverage: 3:271/291 of query aligns to 2:236/244 of 2gcuA
3tp9A Crystal structure of alicyclobacillus acidocaldarius protein with beta-lactamase and rhodanese domains
28% identity, 71% coverage: 2:209/291 of query aligns to 1:198/473 of 3tp9A
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 89% coverage: 9:267/291 of query aligns to 5:223/258 of O24496
Sites not aligning to the query:
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
26% identity, 69% coverage: 10:209/291 of query aligns to 11:189/336 of 3r2uB
Sites not aligning to the query:
7l0bA Crystal structure of hydroxyacyl glutathione hydrolase (glob) from staphylococcus aureus, apoenzyme (see paper)
30% identity, 50% coverage: 50:194/291 of query aligns to 34:169/202 of 7l0bA
Sites not aligning to the query:
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
25% identity, 74% coverage: 18:232/291 of query aligns to 14:204/254 of 2q42A
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
24% identity, 81% coverage: 10:244/291 of query aligns to 9:234/348 of 3r2uA
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
25% identity, 74% coverage: 18:232/291 of query aligns to 84:274/324 of Q9SID3
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
29% identity, 63% coverage: 50:231/291 of query aligns to 35:205/210 of 2xf4A
7ev5A Crystal structure of bleg-1 b3 metallo-beta-lactamase (see paper)
27% identity, 63% coverage: 50:231/291 of query aligns to 33:204/209 of 7ev5A
6n36A Beta-lactamase from chitinophaga pinensis
29% identity, 57% coverage: 44:209/291 of query aligns to 47:228/265 of 6n36A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
26% identity, 69% coverage: 14:214/291 of query aligns to 58:226/308 of Q16775
Sites not aligning to the query:
>HSERO_RS11580 FitnessBrowser__HerbieS:HSERO_RS11580
MDKLHIEGHFDTTTSTVSYLVLDRASGQCALIDTVLDYDPKSGRTATTSADQLIARVREL
GAQVQWILETHAHADHLSAAPYLKQQLGGRIAIGEHITQVQAVFGKLFNAGAAFAHDGSQ
FDQLFADGARFQIGQLQARVMHTPGHTPACLTYVVEEAGHIAAFVGDTLFMPDYGTARCD
FPGGDARTLFRSIQAVLSLPDHAQLYMCHDYRPNGRELRYVTTVAEERRHNIHVHEGVSE
ESFVTMRKARDATLDMPVLLLPSVQVNMRAGQLPPAEDNGVRYLKIPLNAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory