Comparing HSERO_RS11630 FitnessBrowser__HerbieS:HSERO_RS11630 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
46% identity, 95% coverage: 13:356/363 of query aligns to 2:343/343 of P30750
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
46% identity, 95% coverage: 13:356/363 of query aligns to 3:344/344 of 3tuzC
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
46% identity, 95% coverage: 13:356/363 of query aligns to 3:344/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
46% identity, 95% coverage: 13:356/363 of query aligns to 3:344/344 of 6cvlD
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
45% identity, 67% coverage: 13:257/363 of query aligns to 3:241/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
43% identity, 63% coverage: 24:253/363 of query aligns to 11:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
43% identity, 63% coverage: 24:253/363 of query aligns to 11:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
43% identity, 63% coverage: 24:253/363 of query aligns to 11:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
43% identity, 63% coverage: 24:253/363 of query aligns to 11:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
42% identity, 63% coverage: 27:255/363 of query aligns to 12:239/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 67% coverage: 8:252/363 of query aligns to 13:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
37% identity, 67% coverage: 8:252/363 of query aligns to 13:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 66% coverage: 8:245/363 of query aligns to 13:256/260 of 7ahdC
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
43% identity, 58% coverage: 18:228/363 of query aligns to 7:213/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
43% identity, 58% coverage: 18:228/363 of query aligns to 7:213/219 of 8w6iD
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
43% identity, 58% coverage: 18:228/363 of query aligns to 7:213/218 of 8hd0A
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
43% identity, 59% coverage: 18:230/363 of query aligns to 7:215/222 of 8i6rB
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 60% coverage: 13:230/363 of query aligns to 2:223/232 of 1f3oA
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 60% coverage: 13:230/363 of query aligns to 2:223/230 of 1l2tA
8tzjA Cryo-em structure of vibrio cholerae ftse/ftsx complex (see paper)
40% identity, 61% coverage: 11:233/363 of query aligns to 1:220/220 of 8tzjA
>HSERO_RS11630 FitnessBrowser__HerbieS:HSERO_RS11630
LATPARGGPHGKVALRGVGKTYVSAAGPVQALQDIDLEIAPGSIFGIIGRSGAGKSSLLR
TINRLERPTSGRVEVDDVDLATLDETQLVALRRRIGMIFQHFNLLAAKTVFDNIALPLRV
AGVPRAQITQRVHELLALVGLQDKADSYPRRLSGGQKQRVGIARALASGPEILLCDEATS
ALDPETTQSILQLLRDINRKLGITIILITHEMSVIREIADRVLVLEQGRVAELGEVWQVF
GKPQHAATRALLAPLQHGLPQELQQALQPQAPAGRHERVLQLEFHGGDGLQPDLQRIAAV
LGGRVRVLQAGVDHIQGHTHGQLVLAVADAPASHDWLALTQGAQAIAHHIKELGYVADPV
HSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory