Comparing HSERO_RS11635 FitnessBrowser__HerbieS:HSERO_RS11635 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
27% identity, 73% coverage: 58:218/220 of query aligns to 54:215/215 of 4ymtC
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
32% identity, 59% coverage: 66:194/220 of query aligns to 61:182/506 of A0A0H2ZQB9
Sites not aligning to the query:
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
27% identity, 69% coverage: 58:208/220 of query aligns to 54:212/214 of 4ymwC
>HSERO_RS11635 FitnessBrowser__HerbieS:HSERO_RS11635
MSLTLSIPIERYGNALLDTLQMVSVSGALALVAGVPLAVLLIVSAPGGFLDWPRLHRVLG
SVINGFRATPFIVLLVALIPLTRLVAGTTIGVWAAIVPLAISATPFFARIVEVSLREVDP
GLVEAAQALGCRKWDIVWHVYLPEALPGIVGGFTITLVALISSSAMAGAVGAGGLGDLAI
RYGYQRFDTQVMVIVIAMLIVLVSLVQRTGDSYVRRLRNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory