Comparing HSERO_RS11665 FitnessBrowser__HerbieS:HSERO_RS11665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8wm7D Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
41% identity, 86% coverage: 21:245/261 of query aligns to 23:246/257 of 8wm7D
Sites not aligning to the query:
8w9mD Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
41% identity, 86% coverage: 21:245/261 of query aligns to 21:244/256 of 8w9mD
Sites not aligning to the query:
8w9mC Cryo-em structure of the cyanobacterial nitrate transporter nrtbcd in complex with atp (see paper)
38% identity, 98% coverage: 2:256/261 of query aligns to 3:256/256 of 8w9mC
8wm7C Cryo-em structure of cyanobacterial nitrate/nitrite transporter nrtbcd in complex with signalling protein pii (see paper)
39% identity, 98% coverage: 2:256/261 of query aligns to 3:256/658 of 8wm7C
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
41% identity, 73% coverage: 24:214/261 of query aligns to 35:226/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
39% identity, 73% coverage: 26:215/261 of query aligns to 46:242/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
39% identity, 73% coverage: 26:215/261 of query aligns to 46:242/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
38% identity, 73% coverage: 25:215/261 of query aligns to 45:242/260 of 7ahdC
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
38% identity, 76% coverage: 8:206/261 of query aligns to 8:215/226 of 5xu1B
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 73% coverage: 19:208/261 of query aligns to 19:217/375 of 2d62A
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
38% identity, 80% coverage: 1:208/261 of query aligns to 1:219/232 of 1f3oA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 70% coverage: 25:208/261 of query aligns to 22:208/369 of P19566
Sites not aligning to the query:
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
37% identity, 80% coverage: 1:208/261 of query aligns to 1:219/230 of 1l2tA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 72% coverage: 21:207/261 of query aligns to 19:208/393 of P9WQI3
1g291 Malk (see paper)
36% identity, 73% coverage: 19:208/261 of query aligns to 16:214/372 of 1g291
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
39% identity, 75% coverage: 1:195/261 of query aligns to 1:202/343 of P30750
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
38% identity, 70% coverage: 25:208/261 of query aligns to 21:207/371 of 3puyA
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
38% identity, 70% coverage: 25:208/261 of query aligns to 21:207/371 of 3puxA
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
38% identity, 70% coverage: 25:208/261 of query aligns to 21:207/371 of 3puwA
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
38% identity, 70% coverage: 25:208/261 of query aligns to 21:207/371 of 3puvA
Sites not aligning to the query:
>HSERO_RS11665 FitnessBrowser__HerbieS:HSERO_RS11665
MLKVENASVYFSGRDKQRVHALDRVSLDIPNGGFVVALGTSGCGKSTLLNAMAGFLPLSE
GRISLDGQPVSGPGAERGVVFQKDSLLPWKSVQDNVALGLKFAGVSKSDSRERAQELLRL
VGLQDFARAAPYELSGGMRQRVGLARALAPNPKILLMDEPFGALDSMTREQMQELLVSVW
ARTGKQVFFITHSIEEALFLGTEVIVMSPRPGRIVARFETDFVRRFAAGCEARAIKTEPA
FAELREEIRAIVHQSEDLVTS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory