Comparing HSERO_RS12030 FitnessBrowser__HerbieS:HSERO_RS12030 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
41% identity, 44% coverage: 255:468/484 of query aligns to 66:276/285 of 3uf6A
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
41% identity, 44% coverage: 255:468/484 of query aligns to 68:278/288 of 3u9eB
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
40% identity, 27% coverage: 32:161/484 of query aligns to 35:163/168 of P86397
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
41% identity, 27% coverage: 33:161/484 of query aligns to 6:134/134 of O32472
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
33% identity, 27% coverage: 33:162/484 of query aligns to 23:152/165 of A0A3Q7HWE4
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
24% identity, 54% coverage: 199:458/484 of query aligns to 19:306/325 of 1xcoD
6jqoA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ccoa (see paper)
36% identity, 21% coverage: 28:130/484 of query aligns to 528:632/678 of 6jqoA
Sites not aligning to the query:
6jqnA Structure of paaz, a bifunctional enzyme in complex with NADP+ and ocoa (see paper)
36% identity, 21% coverage: 28:130/484 of query aligns to 528:632/678 of 6jqnA
Sites not aligning to the query:
6jqmA Structure of paaz with NADPH (see paper)
36% identity, 21% coverage: 28:130/484 of query aligns to 528:632/678 of 6jqmA
Sites not aligning to the query:
P77455 Bifunctional protein PaaZ; EC 3.3.2.12; EC 1.2.1.91 from Escherichia coli (strain K12) (see paper)
36% identity, 21% coverage: 28:130/484 of query aligns to 529:633/681 of P77455
Sites not aligning to the query:
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 40% coverage: 265:458/484 of query aligns to 499:691/714 of Q8ZND6
Sites not aligning to the query:
8ps2G Asymmetric unit of the yeast fatty acid synthase with acp at the enoyl reductase domain (fasam sample) (see paper)
32% identity, 27% coverage: 33:161/484 of query aligns to 1525:1646/2036 of 8ps2G
Sites not aligning to the query:
8prwG Fatty acid synthase subunit beta (see paper)
32% identity, 27% coverage: 33:161/484 of query aligns to 1523:1644/2034 of 8prwG
Sites not aligning to the query:
8prvG Asymmetric unit of the yeast fatty acid synthase in the non-rotated state with acp at the ketosreductase domain (fasamn sample) (see paper)
32% identity, 27% coverage: 33:161/484 of query aligns to 1523:1644/2034 of 8prvG
Sites not aligning to the query:
6u5uG Electron cryomicroscopy structure of s. Cerevisiae fas in the ks- stalled state (see paper)
32% identity, 27% coverage: 33:161/484 of query aligns to 1522:1643/2033 of 6u5uG
Sites not aligning to the query:
6ql5G Fatty acid synthase subunit beta (see paper)
32% identity, 27% coverage: 33:161/484 of query aligns to 1525:1646/2036 of 6ql5G
Sites not aligning to the query:
7tuiB Structure of c. Albicans fas in an inhibited state
30% identity, 23% coverage: 53:162/484 of query aligns to 1535:1644/2033 of 7tuiB
Sites not aligning to the query:
6u5wB Electron cryomicroscopy structure of c. Albicans fas in the ks-stalled state (see paper)
30% identity, 23% coverage: 53:162/484 of query aligns to 1535:1644/2033 of 6u5wB
Sites not aligning to the query:
7svtB Mycobacterium tuberculosis 3-hydroxyl-acp dehydratase hadab in complex with 1,3-diarylpyrazolyl-acylsulfonamide inhibitor (see paper)
36% identity, 23% coverage: 28:140/484 of query aligns to 3:120/141 of 7svtB
4v8lD Structure of the Mycobacterial Fatty Acid Synthase (see paper)
39% identity, 15% coverage: 49:121/484 of query aligns to 1205:1279/2822 of 4v8lD
Sites not aligning to the query:
>HSERO_RS12030 FitnessBrowser__HerbieS:HSERO_RS12030
MADSLPAPVVADKDAHASDDVLGLIRNRIFSEIAVGDSATITRTLTLADIQLFAVISGDA
NPQHLDLAFAKETRFHGLIAHGMFGGALISAVLGTRLPGPGTIYLGQTLRFVAPVRIGDT
LRTTVTVKERDEARKLLTLACACINQDGVTVIEGEAKVLAPTEPILRRRTSLPEVSMKMG
DADLQLLLEHARKPGPAPVAVVHPCDELSLAAVLDAHAAGLISPILVAPRSRLLALAESH
KLDISAFPLEDVPHSHAAAARAIELVMHGKVEMLMKGSLHTEEFMGAVVACPGLHTKRRM
SHCYLMQTPSYPRPFIITDAAVNIEPGLAEKADIIRNAIELAHVIGVKTPKVAILAAVET
VNPRMPATLDAAALCKMADRGQITGAILDGPLAFDNAVSPVSARVKGIRSEVAGQADILV
VPDLESGNLLAKQLEYMGGAISAGLVLGARIPLILTSRADSRETRLASCAVARMLAQHYR
SAPP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory