SitesBLAST
Comparing HSERO_RS12095 FitnessBrowser__HerbieS:HSERO_RS12095 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
30% identity, 100% coverage: 2:330/330 of query aligns to 3:340/340 of 4n54A
- active site: K96 (= K92), H183 (= H173)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (= R11), K96 (= K92), D156 (= D151), D179 (= D169), M180 (= M170), H183 (= H173), R238 (= R228), Y244 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ F7), G9 (= G8), L10 (≠ A9), G11 (= G10), R12 (= R11), L13 (≠ I12), S35 (≠ D33), V36 (= V34), E40 (≠ A39), S73 (= S69), P74 (≠ S70), F77 (≠ T73), H78 (= H74), E95 (= E91), K96 (= K92), M125 (≠ Q120), F167 (vs. gap), F284 (= F274)
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
27% identity, 98% coverage: 5:328/330 of query aligns to 8:340/342 of 3ceaA
- active site: K98 (= K92), H185 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G8), G13 (= G10), R14 (= R11), L15 (≠ I12), L38 (≠ V34), Q42 (≠ S38), V74 (≠ A68), A75 (≠ S69), P76 (≠ S70), T77 (= T71), F79 (≠ T73), H80 (= H74), M83 (≠ L77), E97 (= E91), K98 (= K92), M127 (≠ Q120), F169 (vs. gap), H185 (= H173), F286 (= F274)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 89% coverage: 6:298/330 of query aligns to 7:295/336 of 3ec7A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), M12 (≠ R11), I13 (= I12), D35 (= D33), I36 (≠ V34), R40 (≠ H35), T73 (≠ A68), A74 (≠ S69), S75 (= S70), N76 (≠ T71), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ Q120), W271 (≠ F274), Y279 (= Y282)
4mjlD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD and d-chiro-inositol
29% identity, 93% coverage: 1:306/330 of query aligns to 2:307/339 of 4mjlD
- active site: K97 (= K92)
- binding (1r,2r,3s,4s,5s,6s)-cyclohexane-1,2,3,4,5,6-hexol: K97 (= K92), H155 (≠ P152), N157 (≠ A154), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ V34), V73 (≠ A68), S74 (= S69), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ Q120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioD Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 93% coverage: 1:306/330 of query aligns to 2:307/339 of 4mioD
- active site: K97 (= K92)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K97 (= K92), H155 (≠ P152), N157 (≠ A154), D172 (= D169), T173 (≠ M170), H176 (= H173), Y236 (= Y234)
- binding 1,4-dihydronicotinamide adenine dinucleotide: A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ V34), S74 (= S69), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ Q120), D172 (= D169), W274 (≠ F274), Y282 (= Y282)
4mioA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei in complex with NAD(h) and myo-inositol
29% identity, 93% coverage: 1:306/330 of query aligns to 2:307/339 of 4mioA
- active site: K97 (= K92)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ V34), S74 (= S69), F75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), W274 (≠ F274), Y282 (= Y282)
4minA Crystal structure of myo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD
29% identity, 93% coverage: 1:306/330 of query aligns to 2:307/339 of 4minA
- active site: K97 (= K92)
- binding nicotinamide-adenine-dinucleotide: G11 (= G10), A12 (≠ R11), M13 (≠ I12), D35 (= D33), I36 (≠ V34), V73 (≠ A68), S74 (= S69), F75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), Y282 (= Y282)
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
25% identity, 90% coverage: 4:299/330 of query aligns to 5:297/337 of 3nt5A
- active site: K97 (= K92), H176 (= H173)
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K97 (= K92), H155 (≠ S149), H176 (= H173), Y235 (= Y234)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (= V34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), E96 (= E91), K97 (= K92), Y280 (= Y282)
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
25% identity, 90% coverage: 4:299/330 of query aligns to 5:297/337 of 3nt4A
- active site: K97 (= K92), H176 (= H173)
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: H155 (≠ S149), H176 (= H173), Y235 (= Y234), W272 (≠ F274)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (= V34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), E96 (= E91), K97 (= K92), H176 (= H173)
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
25% identity, 90% coverage: 4:299/330 of query aligns to 5:297/337 of 3nt2B
- active site: K97 (= K92), H176 (= H173)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), D35 (= D33), V36 (= V34), S74 (= S69), W75 (≠ S70), A78 (≠ T73), K97 (= K92), W272 (≠ F274), Y280 (= Y282)
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
25% identity, 90% coverage: 4:299/330 of query aligns to 5:297/337 of 3nt2A
- active site: K97 (= K92), H176 (= H173)
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), G11 (= G10), A12 (≠ R11), I13 (= I12), D35 (= D33), V36 (= V34), S74 (= S69), W75 (≠ S70), G76 (≠ T71), A78 (≠ T73), H79 (= H74), E96 (= E91), K97 (= K92), H176 (= H173), Y280 (= Y282)
4l8vA Crystal structure of a12k/d35s mutant myo-inositol dehydrogenase from bacillus subtilis with bound cofactor NADP (see paper)
25% identity, 90% coverage: 4:299/330 of query aligns to 5:297/337 of 4l8vA
- active site: K97 (= K92), H176 (= H173)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (≠ R11), I13 (= I12), S74 (= S69), W75 (≠ S70), H79 (= H74), E96 (= E91), K97 (= K92), M126 (≠ Q120), W272 (≠ F274), Y280 (= Y282)
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
27% identity, 95% coverage: 16:330/330 of query aligns to 27:349/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: D44 (= D33), R45 (≠ V34), A80 (= A68), T81 (≠ S69), P82 (≠ S70), H86 (= H74), E103 (= E91), K104 (= K92), N132 (≠ Q120), T169 (≠ L157), W171 (≠ Y159), Y301 (≠ H288)
Sites not aligning to the query:
8qc8D Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
24% identity, 99% coverage: 2:328/330 of query aligns to 2:338/339 of 8qc8D
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), H11 (≠ R11), M12 (≠ I12), D33 (= D33), P34 (≠ V34), T35 (≠ H35), S38 (= S38), A71 (= A68), S72 (= S69), P73 (≠ S70), N74 (≠ T71), H77 (= H74), E96 (= E91), K97 (= K92), E125 (≠ Q120), K162 (≠ P156), V163 (≠ L157), W166 (vs. gap)
8qc8B Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ (see paper)
25% identity, 100% coverage: 2:330/330 of query aligns to 6:367/367 of 8qc8B
- binding nicotinamide-adenine-dinucleotide: H15 (≠ R11), M16 (≠ I12), D37 (= D33), P38 (≠ V34), T39 (≠ H35), S42 (= S38), A75 (= A68), S76 (= S69), P77 (≠ S70), N78 (≠ T71), H81 (= H74), E100 (= E91), K101 (= K92), E129 (≠ Q120), K166 (≠ P156), V167 (≠ L157), W170 (vs. gap), H315 (≠ R284)
8qc2A Crystal structure of NAD-dependent glycoside hydrolase from flavobacterium sp. (Strain k172) in complex with co-factor NAD+ and sulfoquinovose (sq) (see paper)
25% identity, 99% coverage: 2:328/330 of query aligns to 4:363/363 of 8qc2A
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), H13 (≠ R11), M14 (≠ I12), D35 (= D33), P36 (≠ V34), T37 (≠ H35), S40 (= S38), A73 (= A68), S74 (= S69), P75 (≠ S70), N76 (≠ T71), H79 (= H74), E98 (= E91), K99 (= K92), E127 (≠ Q120), K164 (≠ P156), V165 (≠ L157), W168 (vs. gap), H313 (≠ R284)
- binding sulfoquinovose: K99 (= K92), Y128 (≠ R121), R158 (= R150), F161 (≠ G153), L162 (≠ A154), K164 (≠ P156), E181 (≠ D169), H185 (= H173), H313 (≠ R284)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
27% identity, 96% coverage: 1:318/330 of query aligns to 1:323/333 of 4koaA
- active site: K94 (= K92), H180 (= H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), A9 (= A9), S10 (≠ G10), T11 (≠ R11), I12 (= I12), S33 (≠ D33), S34 (≠ V34), R38 (≠ S38), T71 (≠ S69), N73 (≠ T71), H76 (= H74), K94 (= K92), Q160 (vs. gap)
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
23% identity, 91% coverage: 27:327/330 of query aligns to 29:329/340 of 1evjA
- active site: K100 (= K92), Y188 (≠ H173)
- binding nicotinamide-adenine-dinucleotide: D35 (= D33), L77 (≠ S69), P78 (≠ S70), N79 (≠ T71), H82 (= H74), E99 (= E91), K100 (= K92), R128 (≠ Q120), W170 (vs. gap), R171 (≠ P156), Y188 (≠ H173), Y267 (≠ V258)
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
26% identity, 96% coverage: 2:319/330 of query aligns to 3:360/372 of 6a3iA
- binding Levoglucosan: K103 (= K92), Y132 (≠ R121), Y160 (≠ M144), Q162 (≠ L146), R175 (vs. gap), D188 (= D169), H192 (= H173)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F12 (≠ R11), M13 (≠ I12), E42 (≠ D33), A43 (≠ V34), P81 (≠ S70), N82 (≠ T71), L84 (≠ T73), H85 (= H74), E102 (= E91), K103 (= K92), W174 (≠ Y159), R175 (vs. gap)
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
23% identity, 91% coverage: 27:327/330 of query aligns to 60:372/383 of 1h6dA
- active site: K131 (= K92), Y219 (≠ H173)
- binding glycerol: K131 (= K92), R202 (≠ P156), D215 (= D169), Y219 (≠ H173)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S66 (≠ D33), G67 (≠ V34), K71 (≠ S38), Y89 (vs. gap), I107 (≠ A68), L108 (≠ S69), P109 (≠ S70), N110 (≠ T71), H113 (= H74), E130 (= E91), K131 (= K92), R159 (≠ Q120), A198 (≠ G153), W201 (vs. gap), R202 (≠ P156), Y219 (≠ H173), Y298 (≠ H252)
Sites not aligning to the query:
Query Sequence
>HSERO_RS12095 FitnessBrowser__HerbieS:HSERO_RS12095
MIDVAIFGAGRIGKIHAANIAAQAGVRLKYVCDVHAESAAELAQRHGAQVGRVEQVLDDS
SVAAVVIASSTDTHADLILRAAAAGKAIFCEKPVDLDLQRAQACAEAVRAAGVTCMIGFQ
RRFDPTFESLSRRLEAGEIGDPEMLLVTSRDPGAPPLSYIASSGGIFKDMLIHDFDIFRW
ILADEAVSVFATGSCLTDPAIATAGDVDSTAVTLTTRSGRLCQINTSRRAAYGYDQRFEV
LGSKGMLQAGNHRPTEVVAATASQVGSDLPEHFFLERYRAAYAREMAHFFQAMQSGAPVR
TSIEDGVKALQLAEAAATSWRERRIVSLSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory