SitesBLAST
Comparing HSERO_RS12955 FitnessBrowser__HerbieS:HSERO_RS12955 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3toxA Crystal structure of a short chain dehydrogenase in complex with NAD(p) from sinorhizobium meliloti 1021
55% identity, 99% coverage: 4:249/249 of query aligns to 3:254/254 of 3toxA
- active site: G16 (= G17), S142 (= S143), V153 (≠ M154), Y156 (= Y157), K160 (= K161)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), S15 (≠ A16), G16 (= G17), I17 (= I18), A36 (= A37), R37 (= R38), N38 (≠ R39), V63 (= V64), N89 (= N90), A90 (= A91), G91 (= G92), T140 (= T141), S142 (= S143), Y156 (= Y157), K160 (= K161), P186 (= P187), G188 (= G189), T189 (≠ V190), T191 (= T192)
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 4:244/249 of query aligns to 3:244/248 of 4urfB
- active site: G16 (= G17), S142 (= S143), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ M210), R211 (≠ K211), R212 (= R212)
- binding bicarbonate ion: I92 (≠ A93), G94 (= G95), R109 (≠ D110), R179 (= R181), S228 (= S228)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T141), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), I188 (≠ V190), T190 (= T192)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 4:244/249 of query aligns to 3:244/248 of 4urfA
- active site: G16 (= G17), S142 (= S143), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (≠ A93), S93 (≠ V94), G94 (= G95), E95 (≠ A96), T97 (≠ K98), E101 (= E102), T103 (≠ S104), Q106 (= Q107), R109 (≠ D110), S175 (≠ V177), G177 (= G179)
- binding magnesium ion: S237 (≠ T237), Y238 (≠ A238)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), W41 (≠ A42), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), G91 (= G92), I140 (≠ T141), Y155 (= Y157), K159 (= K161), P185 (= P187), I188 (≠ V190), T190 (= T192)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
40% identity, 97% coverage: 4:244/249 of query aligns to 3:244/248 of 4ureB
- active site: G16 (= G17), S142 (= S143), I152 (≠ M154), Y155 (= Y157), K159 (= K161)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ A16), G16 (= G17), I17 (= I18), N89 (= N90), G91 (= G92), Y155 (= Y157), P185 (= P187), A186 (≠ G188)
4fn4A Short-chain NAD(h)-dependent dehydrogenase/reductase from sulfolobus acidocaldarius (see paper)
39% identity, 97% coverage: 3:244/249 of query aligns to 4:250/254 of 4fn4A
- active site: G18 (= G17), S144 (= S143), Y157 (= Y157), K161 (= K161), S202 (≠ Q199)
- binding nicotinamide-adenine-dinucleotide: G14 (= G13), S17 (≠ A16), G18 (= G17), I19 (= I18), E38 (≠ A37), L39 (≠ R38), R43 (≠ A42), A63 (≠ G62), D64 (= D63), V65 (= V64), N91 (= N90), G93 (= G92), I94 (≠ A93), T142 (= T141), S144 (= S143), Y157 (= Y157), K161 (= K161), P187 (= P187), V190 (= V190), T192 (= T192), N193 (≠ D193), I194 (≠ M194)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
38% identity, 97% coverage: 4:244/249 of query aligns to 5:249/261 of 1g6kA
- active site: G18 (= G17), S145 (≠ F144), Y158 (= Y157), K162 (= K161)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ A16), G18 (= G17), L19 (≠ I18), R39 (= R38), D65 (= D63), V66 (= V64), N92 (= N90), A93 (= A91), G94 (= G92), M143 (≠ S142), S145 (≠ F144), Y158 (= Y157), P188 (= P187), G189 (= G188), I191 (≠ V190), T193 (= T192)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
37% identity, 97% coverage: 4:244/249 of query aligns to 5:249/261 of P40288
- 11:35 (vs. 10:34, 40% identical) binding
- E96 (≠ V94) mutation E->A,G,K: Heat stable.
- D108 (≠ Q107) mutation to N: Heat stable.
- V112 (≠ T111) mutation to A: Heat stable.
- E133 (≠ A132) mutation to K: Heat stable.
- V183 (≠ A182) mutation to I: Heat stable.
- P194 (≠ D193) mutation to Q: Heat stable.
- E210 (≠ A205) mutation to K: Heat stable.
- Y217 (≠ R212) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
3ay6B Crystal structure of bacillus megaterium glucose dehydrogenase 4 a258f mutant in complex with nadh and d-glucose (see paper)
37% identity, 97% coverage: 4:244/249 of query aligns to 11:255/267 of 3ay6B
- active site: G24 (= G17), S151 (≠ F144), Y164 (= Y157), K168 (= K161)
- binding beta-D-glucopyranose: E102 (≠ V94), S151 (≠ F144), H153 (≠ G146), W158 (≠ L151), Y164 (= Y157), N202 (≠ G195), K205 (vs. gap)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G20 (= G13), T23 (≠ A16), G24 (= G17), L25 (≠ I18), Y45 (vs. gap), D71 (= D63), V72 (= V64), N98 (= N90), A99 (= A91), G100 (= G92), V101 (≠ A93), M149 (≠ S142), S151 (≠ F144), Y164 (= Y157), K168 (= K161), P194 (= P187), G195 (= G188), M197 (≠ V190), T199 (= T192), P200 (≠ D193), I201 (≠ M194), N202 (≠ G195)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
38% identity, 98% coverage: 1:244/249 of query aligns to 4:243/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (≠ A16), I20 (= I18), T40 (≠ R38), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), I92 (≠ V94), V139 (≠ T141), S141 (= S143), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I187 (≠ V190), T189 (= T192), M191 (= M194)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
39% identity, 98% coverage: 1:244/249 of query aligns to 4:239/243 of 4i08A
- active site: G19 (= G17), N113 (= N115), S141 (= S143), Q151 (≠ M154), Y154 (= Y157), K158 (= K161)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G13), S17 (= S15), R18 (≠ A16), I20 (= I18), T40 (≠ R38), N62 (≠ D63), V63 (= V64), N89 (= N90), A90 (= A91), G140 (≠ S142), S141 (= S143), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), T189 (= T192)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
38% identity, 98% coverage: 4:248/249 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G17), S142 (= S143), Y155 (= Y157), K159 (= K161)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), S15 (≠ A16), G16 (= G17), I17 (= I18), D36 (≠ A37), I37 (≠ R38), A61 (≠ G62), D62 (= D63), T63 (≠ V64), N89 (= N90), A90 (= A91), M140 (≠ T141), S142 (= S143), Y155 (= Y157), K159 (= K161), P185 (= P187), A186 (≠ G188), Y187 (≠ G189), I188 (≠ V190), L192 (≠ M194)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 98% coverage: 3:247/249 of query aligns to 4:254/255 of 5itvA
- active site: G18 (= G17), S141 (= S143), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ A16), G18 (= G17), I19 (= I18), D38 (≠ R39), I39 (≠ Q40), T61 (≠ G62), I63 (≠ V64), N89 (= N90), G91 (= G92), T139 (= T141), S141 (= S143), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I186 (≠ G189), I187 (≠ V190)
2zatA Crystal structure of a mammalian reductase (see paper)
31% identity, 98% coverage: 4:247/249 of query aligns to 3:249/251 of 2zatA
- active site: G16 (= G17), S142 (= S143), L152 (≠ M154), Y155 (= Y157), K159 (= K161), K200 (≠ P198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A12 (≠ G13), T14 (≠ S15), D15 (≠ A16), G16 (= G17), I17 (= I18), S36 (≠ A37), R37 (= R38), K38 (≠ R39), N41 (≠ A42), H62 (≠ D63), N89 (= N90), A91 (≠ G92), V140 (≠ T141), S142 (= S143), Y155 (= Y157), K159 (= K161), P185 (= P187), G186 (= G188), I188 (≠ V190), T190 (= T192), F192 (≠ M194), S193 (≠ G195)
Q8WNV7 Dehydrogenase/reductase SDR family member 4; NADPH-dependent carbonyl reductase; CR; PHCR; NADPH-dependent retinol dehydrogenase/reductase; NDRD; Peroxisomal carbonyl reductase; PerCR; Peroxisomal short-chain alcohol dehydrogenase; PSCD; Short chain dehydrogenase/reductase family 25C member 2; Protein SDR25C2; EC 1.1.1.184; EC 1.1.1.300 from Sus scrofa (Pig) (see 2 papers)
31% identity, 98% coverage: 4:247/249 of query aligns to 31:277/279 of Q8WNV7
- 37:61 (vs. 10:34, 40% identical) binding
- F177 (≠ L151) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to S: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with F-180.
- L180 (≠ M154) Responsible for the stereoselective reduction of 3-ketosteroids into 3alpha-hydroxysteroids and benzil into S-benzoin; mutation to F: Change in stereoselective activity by the reduction of 3-ketosteroids and benzil into 3beta-hydroxysteroid and R-benzoin, respectively; when associated with S-177.
- Y183 (= Y157) active site, Proton acceptor
- K187 (= K161) binding
- N196 (≠ G170) Important for the maintenance of the quaternary structure, the catalytic activity and cold stability
Sites not aligning to the query:
- 277:279 Peroxisomal targeting signal
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
37% identity, 97% coverage: 3:244/249 of query aligns to 2:240/244 of 6t77A
- active site: G16 (= G17), S138 (= S143), Y151 (= Y157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (≠ A16), T37 (≠ R38), L58 (≠ V59), N59 (≠ D63), V60 (= V64), A87 (= A91), G88 (= G92), I89 (≠ V94)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 98% coverage: 3:247/249 of query aligns to 4:226/227 of 5itvD
- active site: G18 (= G17), S141 (= S143), Y154 (= Y157), K158 (= K161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G13), S17 (≠ A16), G18 (= G17), I19 (= I18), D38 (≠ R39), I39 (≠ Q40), T61 (≠ G62), D62 (= D63), I63 (≠ V64), N89 (= N90), T139 (= T141), S141 (= S143), Y154 (= Y157), K158 (= K161), P184 (= P187), G185 (= G188), I187 (≠ V190)
7djsD Crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with NAD
40% identity, 98% coverage: 4:248/249 of query aligns to 3:251/251 of 7djsD
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G16 (= G17), I17 (= I18), D36 (≠ A37), L37 (≠ R38), C61 (≠ G62), D62 (= D63), V63 (= V64), N89 (= N90), A90 (= A91), T140 (= T141), S142 (= S143), Y155 (= Y157), K159 (= K161), A186 (≠ G188), V187 (≠ G189)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
37% identity, 97% coverage: 3:244/249 of query aligns to 1:239/243 of 7emgB
6ci9D Rmm microcompartment-associated aminopropanol dehydrogenase NADP + aminoacetone holo-structure (see paper)
35% identity, 98% coverage: 1:244/249 of query aligns to 4:248/259 of 6ci9D
- active site: G20 (= G17), S145 (= S143), Y159 (= Y157)
- binding 1-aminopropan-2-one: F97 (≠ V94), S145 (= S143), T147 (≠ V145), W156 (≠ M154), Y159 (= Y157), G190 (= G188)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), S18 (= S15), G20 (= G17), I21 (= I18), G40 (≠ A37), R41 (= R38), N42 (≠ R39), D66 (= D63), V67 (= V64), N93 (= N90), G95 (= G92), T143 (= T141), S145 (= S143), Y159 (= Y157), K163 (= K161), P189 (= P187), N191 (≠ G189), I192 (≠ V190), T194 (= T192), G196 (vs. gap), L197 (vs. gap)
3o4rA Crystal structure of human dehydrogenase/reductase (sdr family) member 4 (dhrs4)
31% identity, 99% coverage: 2:247/249 of query aligns to 4:252/254 of 3o4rA
- active site: G19 (= G17), S145 (= S143), F155 (≠ M154), Y158 (= Y157), K162 (= K161), K203 (≠ P198)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A15 (≠ G13), T17 (≠ S15), D18 (≠ A16), G19 (= G17), I20 (= I18), S39 (≠ A37), R40 (= R38), K41 (≠ R39), N44 (≠ A42), H65 (≠ D63), V66 (= V64), N92 (= N90), A94 (≠ G92), S145 (= S143), Y158 (= Y157), K162 (= K161), P188 (= P187), G189 (= G188), L190 (≠ G189), I191 (≠ V190), T193 (= T192), F195 (≠ M194), S196 (≠ G195)
Query Sequence
>HSERO_RS12955 FitnessBrowser__HerbieS:HSERO_RS12955
MNTLQGKVALITGASAGIGRATALLFARHGAALILTARRQDALEQVAALICAQGGRASVV
AGDVGEAATHERGVAMALDEFGGLDIAINNAGAVGACKPLAEISPQQWQDTLHANLTSAF
LGARCQIPAMLARGAGAIVFTSSFVGSSAGLPGMAAYGAAKAGLMGLVKGIAADYAVQGI
RANALLPGGVDTDMGGDPQQKQWAAGLHAMKRIAQPEEIAAAALFLASPMASFVTGTALY
ADGGNSAVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory